SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016179 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000016179
Domain Number 1 Region: 7-261
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 5.75e-39
Family Lysophospholipase 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016179   Gene: ENSMPUG00000016282   Transcript: ENSMPUT00000016423
Sequence length 436
Comment pep:novel scaffold:MusPutFur1.0:GL897060.1:1784920:1798187:1 gene:ENSMPUG00000016282 transcript:ENSMPUT00000016423 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRCYEDEGSWSLSFSGAGFLGLYHVGVTRCLSERAPHLLQGARRFYGSSSGALNAIAIIA
GKSVDFCCSHLLGMVKQVDRLSLGILHPAFAPIEHIRQQLQDSLPSDIHILASRRLGISL
TRWPDGHNIIVTDFATRDEVIQALVCTLYFPFYCGTIPPEFRGERYIDGALSNNLPFADS
PSTITVSPFHGTVDICPQSSSASMHELNAFNASFQISTKNFFLGFAALVPPSPEVVADSC
RQGYLDALRFLERRGLTKEPILWMLASKEPPPPADGSQDTGHDRGQKGDLSLNWAVPNVL
VRDVPDFEQLSPELEAALKRACMRDPSPWARFCRSGLGQALTYLLLPYTLPFEYVYFRSR
RLAVWLPNMPSDLWWMWGVLQSFALEIYSRSKDQLLQLVSLPITSPLQLGAALLVDLAKG
SDLPIRPEGQSAGPAH
Download sequence
Identical sequences M3YXW9
ENSMPUP00000016179 XP_004771220.1.14098 ENSMPUP00000016179

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]