SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016194 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000016194
Domain Number 1 Region: 68-103,179-239
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 1.46e-23
Family FabD-like 0.0033
Further Details:      
 
Domain Number 2 Region: 112-186
Classification Level Classification E-value
Superfamily Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.0000000353
Family Probable ACP-binding domain of malonyl-CoA ACP transacylase 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016194   Gene: ENSMPUG00000016297   Transcript: ENSMPUT00000016438
Sequence length 242
Comment pep:novel scaffold:MusPutFur1.0:GL897060.1:2404515:2426083:1 gene:ENSMPUG00000016297 transcript:ENSMPUT00000016438 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLSRPLLFVSSSSQSTRLVAPHSCLLEPLNSLPACSAEPWTEPLAPTPRPWPHALHLSL
QVIENCVAAAGFSVGEFAALVFAGAMEFSEGLYAVKVRAEAMQEASEAVPSGMLSVLGQP
QSKFNVACLEAQEHCKTLGIESPVCEVANYLFPDCRVISGHLEALQFLRENSSKYHFRRT
KMLPVSGGFHTRLMEPALEPLEQVLKSISVRKPLVSVHSNVDGNRYMQPRHIQKLLVRQG
LA
Download sequence
Identical sequences M3YXY4
ENSMPUP00000016194 ENSMPUP00000016194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]