SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016197 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000016197
Domain Number 1 Region: 15-304
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.46e-73
Family FCH domain 0.0025
Further Details:      
 
Domain Number 2 Region: 428-485
Classification Level Classification E-value
Superfamily SH3-domain 1.84e-20
Family SH3-domain 0.00076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016197   Gene: ENSMPUG00000016300   Transcript: ENSMPUT00000016441
Sequence length 486
Comment pep:novel scaffold:MusPutFur1.0:GL897060.1:2586098:2642396:1 gene:ENSMPUG00000016300 transcript:ENSMPUT00000016441 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVAYDDSVGVEVSSDSFWEVGNYKRTVKRIDDGHRLCSDLMNCLHERARIEKAYAQQLT
EWARRWRQLVEKGPQYGTLEKAWTAVMSEAEKVSELHLEVKASLMNEDFEKIKNWQKEAF
HKQMMGGFKETKEAEDGFRKAQKPWAKKLKEVEAAKKAYHAACKEEKLATSRETNSKADP
SLNPEQLKKLQDKVEKCKQDVLKTREKYEKSLKELDQGTPQYMENMEQVFEQCQQFEEKR
LRFFREVLLEVQKHLDLSNVASYKSIYRDLEQSIKAADAVEDLRWFRANHGPGMSMNWPQ
FEEWSADLNRTLSRREKKKAADGVTLTGINQTGDQALQNKPSSDLSVPSNPARSAQSLSS
YNPFEDEDDTGSTVSEKEDIKAKNVSSYEKTQSYPTDWSDDESNNPFSSTDANGDSNPFD
EDATSGTEVRVRALYDYEGQEHDELSFKAGDELTKIEDEDEQGWCKGRLDNGQVGLYPAN
YVEAIQ
Download sequence
Identical sequences M3YXY7
XP_012900547.1.14098 ENSMPUP00000016197 ENSMPUP00000016197

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]