SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016206 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMPUP00000016206
Domain Number - Region: 71-110
Classification Level Classification E-value
Superfamily Chromo domain-like 0.0227
Family Chromo domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016206   Gene: ENSMPUG00000016309   Transcript: ENSMPUT00000016450
Sequence length 263
Comment pep:novel scaffold:MusPutFur1.0:GL896903.1:28167534:28173282:1 gene:ENSMPUG00000016309 transcript:ENSMPUT00000016450 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPQGTDPRNPDLPSSHPHTVTADHVTGKDKQMDFCWDPWQRCFQTTNGYLADSRSCSSNY
NVAALATSSLVGVVQSIKDHITKPTAMARGRVAHLIEWKGWRAQRSGWELSPAEDEHYCR
LPDELREARFAAGVAEQFAITEATLSAWSSLDDEELHLENSPQDMLQLQDLESVYLQDSL
LSGPSQDDSLLAFSSSGLSPEGWPSPNEPPITAVGPQPPSLEEEHQRRLPRGLGPEGGAH
LQGSLPSVDSISLSEEEDEVFYN
Download sequence
Identical sequences M3YXZ6
XP_004741454.1.14098 ENSMPUP00000016206 ENSMPUP00000016206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]