SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016317 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000016317
Domain Number 1 Region: 114-300
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.3e-74
Family F-box associated region, FBA 0.0000000213
Further Details:      
 
Domain Number 2 Region: 44-144
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000000327
Family F-box domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016317   Gene: ENSMPUG00000016421   Transcript: ENSMPUT00000016562
Sequence length 300
Comment pep:novel scaffold:MusPutFur1.0:GL896903.1:31197837:31237344:1 gene:ENSMPUG00000016421 transcript:ENSMPUT00000016562 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGDGEPESVGQPEEEVSPEGQQEEAGAEEASAGEERPEEEEEEAAAAPYLDELPEPLLL
RVLAELPAAQLVQACRLVCLRWKELVDGAPLWLLKCQQEGLVPEGGAEDERDHWQQFYFL
SKRRRNLLRNPCGEEDLEGWCDVEHGGDGWRVEDLPGDCGAEFIHDESVKKYFASSFEWC
RKAQVIDLQAEGYWEELLDTTQPAIVAKDWYSGRSDAGCLYELTVKLLSEHEDVLAEFSS
GQVAVPPDSDDAGWIQISHTFTDYGPGVRFVRFEHGGQDSVYWKGWFGARVTNSSVWVEP
Download sequence
Identical sequences M3YYA7
XP_004741544.1.14098 ENSMPUP00000016317 ENSMPUP00000016317

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]