SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016320 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000016320
Domain Number 1 Region: 68-251
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.02e-75
Family F-box associated region, FBA 0.00000187
Further Details:      
 
Domain Number 2 Region: 4-83
Classification Level Classification E-value
Superfamily F-box domain 2.09e-16
Family F-box domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016320   Gene: ENSMPUG00000016424   Transcript: ENSMPUT00000016565
Sequence length 255
Comment pep:novel scaffold:MusPutFur1.0:GL896903.1:31225655:31228945:-1 gene:ENSMPUG00000016424 transcript:ENSMPUT00000016565 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVGNINELPENILLELFTHVPARQLLLRCRLVCSLWRDLIDLVTLWKRKCLREGFITED
WDQPVADWKIFYFLRSLHRNLLHNPCAEEGFEFWSLDVNGGDEWKVEDLSKDQRKEFPND
QVKKYFVTSYYTCLKSQVVDLKAEGYWEELMDTTRPDIKVKDWFAARPDCGSKYQLCVQL
LSSAHAPLGTFQPDPATIQQKSDAKWREVSHTFSNYPPGVRYIWFQHGGVDTHYWAGWYG
PRVTNSSITIGPPLP
Download sequence
Identical sequences M3YYB0
ENSMPUP00000016320 XP_004741545.1.14098 XP_004741546.1.14098 XP_004741547.1.14098 ENSMPUP00000016320

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]