SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016323 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000016323
Domain Number 1 Region: 568-652
Classification Level Classification E-value
Superfamily Kix domain of CBP (creb binding protein) 3.14e-36
Family Kix domain of CBP (creb binding protein) 0.00000655
Further Details:      
 
Domain Number 2 Region: 1036-1162
Classification Level Classification E-value
Superfamily Bromodomain 2.09e-35
Family Bromodomain 0.000000569
Further Details:      
 
Domain Number 3 Region: 327-422
Classification Level Classification E-value
Superfamily TAZ domain 7.59e-29
Family TAZ domain 0.000000927
Further Details:      
 
Domain Number 4 Region: 2047-2102
Classification Level Classification E-value
Superfamily Nuclear receptor coactivator interlocking domain 1.22e-24
Family Nuclear receptor coactivator interlocking domain 0.00025
Further Details:      
 
Domain Number 5 Region: 1728-1813
Classification Level Classification E-value
Superfamily TAZ domain 1.7e-24
Family TAZ domain 0.0000024
Further Details:      
 
Domain Number 6 Region: 1664-1710
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000341
Family ZZ domain 0.00016
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000016323
Domain Number - Region: 1242-1281
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00345
Family PHD domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016323   Gene: ENSMPUG00000016427   Transcript: ENSMPUT00000016568
Sequence length 2425
Comment pep:novel scaffold:MusPutFur1.0:GL897060.1:4055581:4137373:-1 gene:ENSMPUG00000016427 transcript:ENSMPUT00000016568 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAENVVEPGPPSAKRPKLSSPALSASASDGTDFGSLFDLEHDLPDELINSTELGLTNGGD
INQLQTSLGIVQDAASKHKQLSELLRSGSSPNLNMGVGGPGQGMASQPQQNSPGLGLINS
MVKSPMAQAGLTSPNMGMGTSGPNQGPTPSAAGMMNSPVNQPALGMNTGMNAGMNPGMLS
AGNGQGMMPNQVMNGSVGAGRGRPNMQYPNPGMGNAGSLMPEPLQQGSPQMGGQTALRGP
QPIKMGMMNNPNPYGSPYTQNSGQQIGASGLGLQIQTKSVLPNNLSPFAMDKKAVPGGGM
PNMGQQQAPQVQQPGLVTPVAQGMGSGAHTADPEKRKLIQQQLVLLLHAHKCQRREQANG
EVRQCNLPHCRTMKNVLNHMTHCQSGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLKN
AGDKRNQQSILTGAPVGLGNTSSLGVGQQSTPSLSTVSQIDPSSIERAYAALGLPYQVNQ
MPTQPQVQAKNQQNQQSGQSPQGMRPMSNMSASPMGVNGGVGVQTSNLLSDSMLHSAINS
QNPMMSENASVASLGPMPTAAQPSSTGIRKQWHEDITQDLRNHLVHKLVQAIFPTPDPAA
LKDRRMENLVAYARKVEGDMYESANNRAEYYHLLAEKIYKIQKELEEKRRTRLQKQNMLP
SAAGMVPVSMNPGPNMGQPQPGMTTNGPLPDPSMIRGSVPNQMMARITPQPGLNQFGQMS
MPQPPIGPRQTSPLQHHGQLAQPGTLNPPMGYGPRMQQPSGQSQFLPQTPFSAQGMNVTN
MPLAPSGGQAPVSQAQMSSSSCPVNSPIMPPGSQGSHIHCPPLPQSALHQNSPSPVPSRT
PTPHHTPPSIGAQQPPATAIPAPVPTPPAMPPGPQTQALHPPPRQTPTPPPTQLPPQVQP
SLPAAPSADQPQQQPLSQQSTAASVPTPTAPLLPPQPATPLSQPAVSLEGQVSNPPSTSS
TEVSSQTIPEKQPSQEVKMEAKMEVEPPEAADAQPEDVTESKAEDCKMEPTETEERGTEL
KTETKEEEDQPSTSATQSSPAPGQSKKKIFKPEELRQALMPTLEALYRQDPESLPFRQPV
DPQLLGIPDYFDIVKSPMDLSTIKRKLDTGQYQEPWQYVDDIWLMFNNAWLYNRKTSRVY
KYCSKLSEVFEQEIDPVMQSLGYCCGRKLEFSPQTLCCYGKQLCTIPRDATYYSYQNRYH
FCEKCFNEIQGESVSLGDDPSQPQTTINKEQFSKRKNDTLDPELFVECTECGRKMHQICV
LHHEIIWPSGFVCDGCLKKSARTRKENKFSAKRLPSTRLGTFLENRVNDFLRRQNHPESG
EVTVRVVHASDKTVEVKPGMKARFVDSGEMAESFPYRTKALFAFEEIDGVDLCFFGMHVQ
EYGSDCPPPNQRRVYISYLDSVHFFRPKCLRTAVYHEILIGYLEYVKKLGYTTGHIWACP
PSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAVSERIVHDYKDIFKQATEDRLTSAK
ELPYFEGDFWPNVLEESIKELEQEEEERKREENTGHESADVTKGDSKNAKKKNNKKTSKN
KSSLSRGNKKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLIAGPAANSLPPIVDPDPLI
PCDLMDGRDAFLTLARDKHLEFSSLRRAQWSTMCMLVELHTQSQDRFVYTCNECKHHVET
RWHCTVCEDYDLCITCYNTKNHDHKMEKLGLGLDDESNSQQAAATQSPGDSRRLSIQRCI
QSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQEN
KCPVPFCLNIKQKLRQQQLQHRLQQAQMLRRRMASMQRTGVVGQQQGLPSPTPATPTTPT
GQQPATPQTPQPQPPSQPQPTPPNSMPPYLPRTQPAGPVSQGKAAGQVTPPTPPQTAQPP
LPGPPPAAVEMAMQIQRAAETQRQMAHVQIFQRPIQHQMPQMTPMAPMGMNPPPMTRGPS
GHLEAGMGPAGMQQQPQWVQGGLPPPQQLQPGMPRPPAMMSVAQHGQPLNIAPQPGLGQV
GVSPLKPGTVSQQALQNLLRTLRSPSSPLQQQQVLSILHANPQLLAAFIKQRAAKYASSN
PQPLPGQPGMAQGQPGLQPPTLPGQQGAHSNPAVPNMNPMQAGVQRAGLPQQQPQPQLQP
PMGGMSPQAQQMNMNHGTMPSQFRDILRRQQMMQQQQQQGAGPGLGPGMANHNQFQQPQG
VGYPPPPPPPQQQPPPRMQHHMQQMQQGSMGQMGQLPQALGAEAGASLQAYQQRLLQQQM
GSPAQPNPMSPQQHMLPSQAQSPHLQGQQIPSSLSNQVRSPQPVPSPRPQSQPPHSSPSP
RMQPQPSPHHVSPQTSSPHPGLVAAQANPMEQGHFASPDQSSMLSQLASNPGMANLHGAS
ATDLGLSTDNSDLNSNLSQSTLDIH
Download sequence
Identical sequences M3YYB3
ENSMPUP00000016323 ENSMPUP00000016323 XP_004771322.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]