SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016329 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000016329
Domain Number 1 Region: 119-342
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 6.54e-82
Family Fibrinogen C-terminal domain-like 0.000000974
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016329   Gene: ENSMPUG00000016433   Transcript: ENSMPUT00000016574
Sequence length 344
Comment pep:novel scaffold:MusPutFur1.0:GL896903.1:31607748:31612635:-1 gene:ENSMPUG00000016433 transcript:ENSMPUT00000016574 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKKTLSAVTWLCIFITAFVSHPAWPQKPPKRKTPAQLKVAACCEEAKELRAQMANLSSL
LSDLSQKQERDWVSVVMQVMELESSTKRMESRLTDAESKYSEMNNQIDIMQLQAAQTLTQ
TSADAIYDCSSLYQKNYRISGVYKLPPDDFLGSPELEVYCDMETSGGGWTTIQRRKSGLV
SFYRDWRQYKQGFGNIRGDFWLGNDHIHRLSRRPTRLRVEMEDWEGSMRYAEYSRFALGN
ELNSYRLFLGNYSGNAGNDALIYHNNTAFSTKDKDNDNCLDKCAQLRKGGYWYNCCTDSN
LNGVYYRLGEHKKHLDGITWYGWHGSSYSLRRVEMKIRPEDFQP
Download sequence
Identical sequences M3YYB9
XP_004741557.1.14098 ENSMPUP00000016329 ENSMPUP00000016329

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]