SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016345 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000016345
Domain Number 1 Region: 222-303
Classification Level Classification E-value
Superfamily C-terminal domain of DFF45/ICAD (DFF-C domain) 2.62e-31
Family C-terminal domain of DFF45/ICAD (DFF-C domain) 0.0000358
Further Details:      
 
Domain Number 2 Region: 9-94
Classification Level Classification E-value
Superfamily CAD & PB1 domains 4.32e-31
Family CAD domain 0.00000961
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016345   Gene: ENSMPUG00000016449   Transcript: ENSMPUT00000016590
Sequence length 327
Comment pep:novel scaffold:MusPutFur1.0:GL896903.1:32191118:32198222:1 gene:ENSMPUG00000016449 transcript:ENSMPUT00000016590 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVVGEAETETRALKPCLLRRNHSREQHGVAASCLEELRRKACDILAIDKSLAPVTLVLA
EDGTIVDDDDYFLCLPSNTKFVALANNEKWAYSNSDGGTAWISQESFDVDETDSGAGLKW
KHVARQLKEDLSSIILLSEEDLQVLIDVPCSDLAQELCQSCITVQGLQNTLQQVLDQREE
ARQSKQLLELYLQALEKEGSILSKQQESSASFSDDMDAVDAGTNRESSSGVTLTGQVLTA
LKEKPAPELSLSSRDLELVTKEDPRALAAALSWDVKKTETVQQACRQELGRRLQQVQSLR
SLRSMSTRKSSPPGEPPEPKRAKQEPA
Download sequence
Identical sequences M3YYD5
ENSMPUP00000016345 ENSMPUP00000016345 XP_004741572.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]