SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016358 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000016358
Domain Number 1 Region: 119-267
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 5.53e-33
Family Hypothetical protein AT3g04780/F7O18 27 0.00027
Further Details:      
 
Domain Number 2 Region: 4-109
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.75e-22
Family Thioltransferase 0.00000326
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016358   Gene: ENSMPUG00000016461   Transcript: ENSMPUT00000016603
Sequence length 288
Comment pep:novel scaffold:MusPutFur1.0:GL896913.1:1956801:1990442:-1 gene:ENSMPUG00000016461 transcript:ENSMPUT00000016603 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVGVKPVGSDPDFQPELSGAGSRLAVVKFTMRGCGPCLRIAPAFSSMSNKYPQAVFLEVD
VHQCQGTAATNNISATPTFLFFRNKVRIDQYQGADAVGLEEKIKQHLENDPGSNEDTDIP
KGYLESMSVLYKSGLDCLLLFFPHYWNNCCKTLTMLVNKIQCQLLITVAFNQPVKLYSMK
FQGPDNGQGPKYVKIFINLPRSMDFEEAERSEPTQALELTEDDIKEDGIVPLRYVKFQNV
NSVTIFVQSNQGEEETTRISYFTFIGTPVQATNMNDFKRVVGKKGESH
Download sequence
Identical sequences M3YYE8
ENSMPUP00000016358 ENSMPUP00000016358

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]