SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016372 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000016372
Domain Number 1 Region: 223-454
Classification Level Classification E-value
Superfamily Caspase-like 5.98e-39
Family Caspase catalytic domain 0.015
Further Details:      
 
Domain Number 2 Region: 11-96
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000984
Family I set domains 0.035
Further Details:      
 
Domain Number 3 Region: 117-199
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000239
Family I set domains 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016372   Gene: ENSMPUG00000016475   Transcript: ENSMPUT00000016617
Sequence length 716
Comment pep:known scaffold:MusPutFur1.0:GL896913.1:3695150:3746699:1 gene:ENSMPUG00000016475 transcript:ENSMPUT00000016617 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERTEVLLLLSPPGIKITVNPESKAVLAGQFVKLCCRATGHPFVQYQWFKMNKEIPNGNA
SELIFNTVHVKDAGFYVCRVNNNFTFEFSQWSQLDVCDITEVTGSFQGSVDGVSESRLQI
CVEPRSQKLMLGSTLVLQCVAVGSPIPHYQWFKNESPLIHETKKLYMVPYVDLEHQGTYW
CHVYNDRDSQDSKKVEIIIGRTDEAVECTEDELNNLGHPDNKEQTADQPLAKDKVALLIG
NMNYWEHPKLKAPLVDVYELTNLLRQLDFKVVSLLDLTEYEMRNAVDEFLLLLDKGVYGL
LYYAGHGYENFGNSFMVPVDAPNPYRSENCLCVQNILKLMQEKETGLNVFLLDMCRKRND
YDDTIPILDALKVTANIVFGYATCQGAEAFEIQHSGLANGIFMKFLKDRLLEDKKITVLL
DEVAEDMGKCHLTKGKQALEIRSSLSEKRALTDPIQGTAYSAESLVRNLQWAKAHELPES
MCLKFQCGVQIQLGFAAEFSNVMIIYTSIVHKPPDVLMCDAYVTDFPLDLDIDPKDANKG
TPEETGSYLVSKDLPKHCLYTRLSSLQKLKEHLIFTVCLSYQYSGLEDTVEEKQEVNVGK
PLIAKLDIHRGLGRKTCFQTCIMCNGPYQTAASTSAGTGRYPSSQDSFPGVYHSHLGNSS
NVLPSDDCRCSRMADAFISSHHTHHYPCQFGRSNVPVETTDDMPFNLSEGLRISEN
Download sequence
Identical sequences M3YYG2
ENSMPUP00000016372 XP_012908202.1.14098 ENSMPUP00000016372

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]