SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016494 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000016494
Domain Number 1 Region: 141-248
Classification Level Classification E-value
Superfamily Cadherin-like 1.86e-24
Family Cadherin 0.0003
Further Details:      
 
Domain Number 2 Region: 358-475
Classification Level Classification E-value
Superfamily Cadherin-like 5.57e-24
Family Cadherin 0.0024
Further Details:      
 
Domain Number 3 Region: 250-362
Classification Level Classification E-value
Superfamily Cadherin-like 4.28e-18
Family Cadherin 0.0013
Further Details:      
 
Domain Number 4 Region: 462-571
Classification Level Classification E-value
Superfamily Cadherin-like 2.57e-17
Family Cadherin 0.0022
Further Details:      
 
Domain Number 5 Region: 63-148
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000000357
Family Cadherin 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016494   Gene: ENSMPUG00000016598   Transcript: ENSMPUT00000016740
Sequence length 771
Comment pep:novel scaffold:MusPutFur1.0:GL896913.1:9865778:9961808:-1 gene:ENSMPUG00000016598 transcript:ENSMPUT00000016740 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNCCFLLPFILGIPLIWPCFTATEISTTEEVGHPVGSHFRVKRGWMWNQFFVPEERNETN
YHIGQLRSDLDNGNNSFQYKLLGAGAGSIFVIDERTGDIYAVQKLDREERSLYTLRAQVI
DSTTGRAVEPESEFVIRVSDINDNEPKFLDEPYEAIVPEMSPEGTLVIQVTANDADDPSS
GNNARLLYSLLQGQPYFSIEPTTGVIRISTKMDRELQDEYWVIIQAKDMIGLPGALSGTT
SVLIKLSDVNDNKPIFKDRLYRFTVSESAPAGTSIGKIMAYDNDIGENAEMDYSIEDDSQ
TFDIITNNKTQEGIVILKKRVDFEHQNQYRFRANVKNRHVEEKLMEYHVEASTTFIRVQV
EDEDEPPVFLVPYYLFEIFEESPHGSFVGMVFAIDPDQRKSPIRYSMTRSKVFSIDDNGT
IVTTNPLDREISAWYNLSITATEKYNVQQTSAVPVYVQVLNINDHAPEFSEYYDTYVCEN
AGSGQVIQTISAVDRDESSEDHHFYFHLSGEDTKNSSFIIIDNEDNTAVILTNRTGFSLQ
EEPVFYISVLIADNGIPSLTSTNTLTIHICDCDDHGSTQACRNKDLMLAMGFRTEVILAV
LISVMIIFGFIFLILGLKQRRKPTLFAEKSEAFRENVFSYDDEGGGEEDTEAFDLAPLRS
SAVLRERTARGAAGAQIRSLYRQSLQPGPDSAVFRKFILEKLEEANTDPCAPPFDSLQTY
AFEGTGSSAGSLSSLGSAASDQDENYDDLNELGPRFKRLACMFGSAMQSNN
Download sequence
Identical sequences M3YYT4
ENSMPUP00000016494 XP_004745670.1.14098 XP_004745671.1.14098 ENSMPUP00000016494

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]