SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016654 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000016654
Domain Number 1 Region: 222-477
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.21e-65
Family Eukaryotic proteases 0.000000206
Further Details:      
 
Domain Number 2 Region: 50-167
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 8.5e-24
Family Spermadhesin, CUB domain 0.00026
Further Details:      
 
Domain Number 3 Region: 183-230
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000438
Family Complement control module/SCR domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016654   Gene: ENSMPUG00000016759   Transcript: ENSMPUT00000016903
Sequence length 481
Comment pep:novel scaffold:MusPutFur1.0:GL897020.1:4835738:4849934:1 gene:ENSMPUG00000016759 transcript:ENSMPUT00000016903 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNSRCLVSEWGNDHWRSPHSTSCPGKMWWLLLWEVLQACPTHGSVLLAQQLPQQLTSPG
YPEPYLRGQESTTDIEAPEGFAVRLVFQDFDLEPSQDCEQDSVTITASGMDPSRFCGQQG
SPLGSPPGQMEFVSPGNRLRLTFRAPASSQDRTTDLHKGFLALYQAVRVNHSLPISARED
NPSQIQNHCREPYYQAVPAGTLTCTPQFPWKKTQDREELPHCVPVCGRPVTPIAKNQEAL
GSSKAKPGNFPWQAFTNIYGRGGGALLGDRWILTAAHTIYPKDGIFVGRNRSVDVFLGHT
SIDEMLRLGSHPVRRVVVHPDYQPQESHNFDGDIALLELQRSVPLGPGLLPVCLPEREAL
YRSGVWGLVSGFGVDRGWLTTELKYTSLPVAPRAACRAWLRERQRSELFSANMFCAGDET
RQQSVCQGDSGGVFVVWDERAHRWVATGIVSWGVGCGKGYGFYTKVLNYLDWIKAVMDGK
D
Download sequence
Identical sequences M3YZ94
ENSMPUP00000016654 ENSMPUP00000016654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]