SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016655 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000016655
Domain Number 1 Region: 447-701
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.45e-69
Family Eukaryotic proteases 0.00000000821
Further Details:      
 
Domain Number 2 Region: 23-141
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.22e-29
Family Spermadhesin, CUB domain 0.00011
Further Details:      
 
Domain Number 3 Region: 192-304
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.36e-27
Family Spermadhesin, CUB domain 0.0000415
Further Details:      
 
Domain Number 4 Region: 376-456
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000278
Family Complement control module/SCR domain 0.0000341
Further Details:      
 
Domain Number 5 Region: 308-379
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000334
Family Complement control module/SCR domain 0.0000186
Further Details:      
 
Domain Number 6 Region: 138-190
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000201
Family EGF-type module 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016655   Gene: ENSMPUG00000016760   Transcript: ENSMPUT00000016904
Sequence length 705
Comment pep:novel scaffold:MusPutFur1.0:GL897020.1:4852220:4861645:1 gene:ENSMPUG00000016760 transcript:ENSMPUT00000016904 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWLLYLLGPVLFCCMGGSIPVSQKLFGEVTSPLYPKPYPSNFEKTTVITVPTGFRVKLVF
WQFDLEPSEGCLYDYVKISADKKTLGRFCGQLGSPLGNLPEGKEFVSQGNKMLLTFHTDF
SNEENGTIMFYKGFLAYYQAVDLDECASQSNSAEETLQPQCQHLCHNYVGGYFCSCRPGY
ELQEDRHSCQAECSSELYTEPSGYVASLEYPQPYPPDLRCNYSIRVERGLTLHLKFLEPF
EIDDHQQVHCPYDQLQIYANGRNIGEFCGNQRPADFDSNSNAVDLLFFTDDSGDSRGWKL
HYTTEIIKCPQPQTLDEFTIIQDLQPQYQFRDYFIATCQQGYQLVEGDQVLLSFTAVCQD
DGTWHRAMPRCKIKDCGPPRSLTNGAFSYTTTKGVNTYQARIQYSCQEPYYKMHTRGGIS
EIARGTYTCTAEGIWKNEWEGSKIPRCLPVCGKPVHPVEQKQRIIGGQKAKLGNFPWQAF
TNIYGRGGGALLGDRWILTAAHTLYPKDHDKEGNATVDVFLGHVDVEEITKLGNHPVRRV
SIHPDYRQDESNNFEGDIALLELENSVTLGPNLLPICLPDNETFYDRGLMGYVSGFGIME
ERLSYDLKFIRLPVAKRESCENWLRKNKRKDVFSQNMFCAGDPSLKQDACQGDSGGVFAV
KDENSDRWVATGIVSWGIGCSRGYGFYTKLLNYVDWIKKEMEGEG
Download sequence
Identical sequences M3YZ95
XP_004766683.1.14098 ENSMPUP00000016655 ENSMPUP00000016655

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]