SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016656 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000016656
Domain Number 1 Region: 431-689
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.81e-73
Family Eukaryotic proteases 0.0000000302
Further Details:      
 
Domain Number 2 Region: 25-137
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-30
Family Spermadhesin, CUB domain 0.000000656
Further Details:      
 
Domain Number 3 Region: 180-294
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.7e-24
Family Spermadhesin, CUB domain 0.0000688
Further Details:      
 
Domain Number 4 Region: 365-435
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000208
Family Complement control module/SCR domain 0.0000325
Further Details:      
 
Domain Number 5 Region: 305-368
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000131
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 6 Region: 133-177
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000358
Family EGF-type module 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016656   Gene: ENSMPUG00000016761   Transcript: ENSMPUT00000016905
Sequence length 695
Comment pep:novel scaffold:MusPutFur1.0:GL897020.1:4878061:4888042:-1 gene:ENSMPUG00000016761 transcript:ENSMPUT00000016905 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKFPEMWSFFVFSLLASVYAEPTMYGEILSPNYPQAYPNEIEKSWDIEVPEGYGIHLYF
THLDIELSENCAYDSVQIMSGDFEEGKLCGQRTSKNPSSPIVEEFQVPYNKLQVVFKSDF
SNEERFTGFAAYYVAVDINECTDFADAPCSHFCNNFIGGYFCSCPPEYFLHDDMKNCGVN
CSGDVFTTLIGEIASPNYPNPYPENSRCEYQILLEEGYQVVVTMRREDFDVEPADSEGHC
PDSLLFVARDKQFGPYCGNGFPEPLNIETKSNTLNVIFQTDETGQKKGWKLRYRGDPIPC
PKKVTANSVWEPEKPKYVFKDVVKITCLEGFEVVQGSVGSTSFYSTCQSNGKWSNSKLKC
QPVDCGSPEPIRNGKVEDPEHTLFGSVIHYTCEEPYYYLEDEESGEYHCAGNGSWVNKLL
GAELPKCVPVCGVPSKPFKGTQRIFGGIIAEIQNFPWQVFFENPWAGGALIDEYWVLTAA
HVVEGNRDPVMYVGSTSVVTSELRKAQMLTAERVIIHPDWVFLDAPETRKNFDNDIALVQ
LREPVKMGPTVSPICLPGTSSEYNPSVGDLGLISGWGRTKGRDHVILLRGAMLPIAPLEK
CREVKGKNVKVDINSYVFTNNMICAGGEKGVDSCEGDSGGAFAVRVPNEETLKFYVAGLV
SWGPQCGTYGIYTRVQNYLDWITKTIQENSTPRMD
Download sequence
Identical sequences M3YZ96
XP_004766684.1.14098 XP_004766685.1.14098 ENSMPUP00000016656 ENSMPUP00000016656

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]