SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016735 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000016735
Domain Number 1 Region: 206-238
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000082
Family PHD domain 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016735   Gene: ENSMPUG00000016840   Transcript: ENSMPUT00000016984
Sequence length 239
Comment pep:known scaffold:MusPutFur1.0:GL897020.1:5236068:5242125:1 gene:ENSMPUG00000016840 transcript:ENSMPUT00000016984 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAGMYLEHYLDSIENLPFELQRNFQLMRDLDQRTEDLKAEIDKLATEYMNSARSLSSEE
KLALLKQIQEAYGKCKEFGDDKVQLAMQTYEMVDKHIRRLDTDLARFEADLKEKQIESSD
YDSSSSKGKKKGRTQKEKKAARARSKGKNSDEEAPKAAQKKLKLVRTSPEYGMPSVTFGS
VRPPRFLQSPLPRAPDFCFFHLPPFQCSIEWFHFACVGLTTKPRGKWFCPRCSQERKKK
Download sequence
Identical sequences M3YZH5
ENSMPUP00000016735 ENSMPUP00000016735

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]