SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016739 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000016739
Domain Number 1 Region: 324-402
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 4.71e-25
Family Intermediate filament protein, coiled coil region 0.0000407
Further Details:      
 
Domain Number 2 Region: 92-128
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000000134
Family Intermediate filament protein, coiled coil region 0.0016
Further Details:      
 
Domain Number 3 Region: 99-207
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00000785
Family Myosin rod fragments 0.018
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000016739
Domain Number - Region: 213-322
Classification Level Classification E-value
Superfamily Prefoldin 0.00863
Family Prefoldin 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016739   Gene: ENSMPUG00000016844   Transcript: ENSMPUT00000016988
Sequence length 500
Comment pep:novel scaffold:MusPutFur1.0:GL896923.1:2446481:2459404:-1 gene:ENSMPUG00000016844 transcript:ENSMPUT00000016988 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSFGSEHYLCASSSYRKVFGDGSRLSSRLSSAGGAGSFRSQSLSRCNVASSAACSSASSL
GLGLAYRRPPASDGLDLSQAAARTNEYKIIRTNEKEQLQGLNDRFAVFIEKVHQLETQNR
ALEAELAALRQRHAEPSRVGELFQRELRDLRAQLEEASSARAQALLERDGLAEEVQRLRA
RCEEESRGREGAERALKAQQRDVDGATLARLDLEKKVESLLDELAFVRQVHDEEVAELLA
TLQASSQAAAEVDVAVAKPDLSSALREIRAQYESLAAKNLQSAEEWYKSKFANLNEQAAR
STEAIRASREEIHEYRRQLQARTIEIEGLRGANESLERQILELEERHSAEVASYQDSIGQ
LENDLRNTKSEMARHLREYQDLLNVKMALDIEIAAYRKLLEGEETRFSTSGLSISGLNPP
PNPAYLLPPRILSSTTSKVSSTGLSFKKEEEEEEEASKATSKKTSQIGESFEEILEETVI
STKKTEKSIIEESTTSSQKI
Download sequence
Identical sequences M3YZH9
ENSMPUP00000016739 ENSMPUP00000016739 XP_004749404.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]