SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016811 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000016811
Domain Number 1 Region: 403-488
Classification Level Classification E-value
Superfamily DEATH domain 5.72e-24
Family DEATH domain, DD 0.0000126
Further Details:      
 
Domain Number 2 Region: 138-181
Classification Level Classification E-value
Superfamily TNF receptor-like 6.12e-16
Family TNF receptor-like 0.00018
Further Details:      
 
Domain Number 3 Region: 81-137
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000000000226
Family TNF receptor-like 0.0000278
Further Details:      
 
Domain Number 4 Region: 182-233
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00000000247
Family TNF receptor-like 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016811   Gene: ENSMPUG00000016915   Transcript: ENSMPUT00000017060
Sequence length 501
Comment pep:novel scaffold:MusPutFur1.0:GL897020.1:5507388:5519521:1 gene:ENSMPUG00000016915 transcript:ENSMPUT00000017060 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLPTVPGLLLPLKQFSEGPWLLRMFRIAAMDPCKCSFREGGTCVDMMFQVLLALLVEIY
PLRVMALVPHVRNREKRAILCPQGKYIHPQDNSICCTKCHKGTYLYKDCPGPGLDTDCRE
CENGTFTASENHLTQCLSCSKCRKEMNQVEISPCTVSQDTVCGCRENQYRRYWSATLFEC
MNCSLCLNGTVHISCTEKQNTVCTCHAGFFLRVNECIPCVHCKENTECKKLCLLPVEKVT
VPQDPGTTVLLPLVIFFGICVLSFSVVLMCRYQRQMPRFFSTVCGKSTPTKEGEPETLAS
VPGFSPTTSFSPTTGFSPTTGFSPIPGFSPIPNPTFTPRSVFTPRDWSKLRAPSEAGEMA
PPYQEAGPKLSAAPASTPIPTPVQKWEDRTHIQRAEADPADPATLYAVVDGVPPSRWKEF
VRRLGLSEHEIERLELQNGRCLREAHYSMLAAWRRRTPRREATLELLGCVLRDMDLLGCL
EDIEEALRAPPSLSPAPRLLR
Download sequence
Identical sequences M3YZQ0
ENSMPUP00000016811 ENSMPUP00000016811

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]