SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016832 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000016832
Domain Number 1 Region: 287-495
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 6.85e-56
Family Reprolysin-like 0.00097
Further Details:      
 
Domain Number 2 Region: 580-636
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000693
Family TSP-1 type 1 repeat 0.00043
Further Details:      
 
Domain Number 3 Region: 1101-1159
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000615
Family TSP-1 type 1 repeat 0.003
Further Details:      
 
Domain Number 4 Region: 1177-1233
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000693
Family TSP-1 type 1 repeat 0.0066
Further Details:      
 
Domain Number 5 Region: 1374-1433
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000131
Family TSP-1 type 1 repeat 0.0037
Further Details:      
 
Domain Number 6 Region: 1043-1102
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000017
Family TSP-1 type 1 repeat 0.0053
Further Details:      
 
Domain Number 7 Region: 1546-1607
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000209
Family TSP-1 type 1 repeat 0.0039
Further Details:      
 
Domain Number 8 Region: 1228-1289
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000641
Family TSP-1 type 1 repeat 0.004
Further Details:      
 
Domain Number 9 Region: 1321-1377
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000916
Family TSP-1 type 1 repeat 0.0025
Further Details:      
 
Domain Number 10 Region: 986-1047
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000994
Family TSP-1 type 1 repeat 0.0031
Further Details:      
 
Domain Number 11 Region: 1610-1670
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000107
Family TSP-1 type 1 repeat 0.0047
Further Details:      
 
Domain Number 12 Region: 1438-1492
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000131
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 
Domain Number 13 Region: 1675-1724
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000157
Family TSP-1 type 1 repeat 0.0042
Further Details:      
 
Domain Number 14 Region: 1490-1548
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000127
Family TSP-1 type 1 repeat 0.0053
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000016832
Domain Number - Region: 871-927
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000144
Family TSP-1 type 1 repeat 0.0044
Further Details:      
 
Domain Number - Region: 928-987
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00157
Family TSP-1 type 1 repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016832   Gene: ENSMPUG00000016936   Transcript: ENSMPUT00000017081
Sequence length 1930
Comment pep:novel scaffold:MusPutFur1.0:GL896899.1:13570348:13733571:-1 gene:ENSMPUG00000016936 transcript:ENSMPUT00000017081 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQFVSWATLLTFLVRDLAEMGSPDAAAAVRKDRLHPRQVKLLETLREYEIASPIRVNALG
EPFSTNVHFKRRRRSIKAASDPWPAFASSSTSSQEHYRLSAFGQQFLFNLTAHAGFIAPT
FTVTLFGTPGENETKFYSEEETELKHCFYKGHVNTKSEHTAVINLCSGMLGTFRSHDGDY
FIEPLLSMDEQEDEDEQNKPHIVYRHSTLHREPSTGRRACDTPEHKNSHSKDKRKMKTRR
LGDRPSLAEDVAVLKASLATKALSAYSNKTDSIREKRTHRRTKRFLSYPRFVEVMVVADY
KMVLYHGPNLQHYILTLMSIVASIYKDPSIGNLINIVIVNLVVIHNEQEGPSISFNAQAT
LKNFCQWQHSKNSQGGIQHDTAVLVTRQDICRAHDKCDTLGLAELGTICDPYRSCSISED
SGLSTAFTIAHELGHVFNMPHDDNNKCKEEGVKSPQHVMAPTLNFYTNPWLWSKCSRKYI
TEFLDTGYGECLLNEPESRSYPLPPQLPGLLYDVNKQCELIFGPGSQVCPYMMQCRRLWC
NNVDGVCRTQHTPWADGTECEPGKHCKFGFCVPKEMEAPVTDGSWGSWSPFGTCSRTCGG
GIKTAIRECNRPEPKNGGKYCVGRRMKFKSCNTEPCLKQKRDFREEQCAHFDGKHFNING
LLPSVRWVPKYSGILMKDRCKLFCRVAGSTAYYQLRDRVVDGTPCGQDTSDICVQGLCRQ
AGCDHILNSKARRDKCGVCGGDNSSCKTVAGTFNTVHYGYNTVVRIPAGATNIDVRQHSF
SGKSEDDNYLALSSSKGEFLLNGDFVVTMSKREIRIGNAVIEYSGSDNVVERINSTDRIE
QELLLQVLSVGKLYNPDVRYSFNIPIEDKPQQFYWNSHGPWQACSKPCQGERKRKPVCTR
ESDQLTVSDQRCDRLPQPAPITEPCGTDCDLRWHIASRSECSAQCGLGYRTLDIYCAKYS
RLDGKTEKVDDSFCSGHPKPSNQEKCSGECNMGGWRYSAWTECSKSCDGGSQRRRAICVN
TRNDVLDDSKCSHQEKVTVQRCSEFPCPQWETADWSECLVTCGKGHKHRQVWCQFGEDRL
SDRLCDPETKPASMQTCQQPECASWQAGPWGQCSVTCGQGYQLRAVKCIIGTYMSVVDDN
DCNAATRPTDTQDCELPSCHPPPAVPETRRSTHSAPRTQWRFGSWTPCSATCGKGTRMRY
VSCRDEDGSVADESACVTLPRPVAKEECSVTPCGRWKALDWSPCSVTCGQGRATRQVVCV
NYSDHVIDQSECDPDYIPETDQDCSTSPCPQRTPDSGLAQHPFHHEDSRPRSAGPSRTHV
LGGNQWRTGPWGACSSTCAGGSQRRVVVCQDENGYTANDCVERIKPDEQRACESGPCPQW
AYGNWGECTKLCGGGLRTRLVVCQRPSGERFPDLSCEIHDKPPDREQCNTHVCPQDAAWN
TGPWSSCSVSCGRGHKQRNVYCMAKDGSHLESDYCKHLAKPNGLRKCRGGRCPKWKAGAW
SQCSVSCGQGTRRRSVGCQMGAHKIARESDCNPYTRPESEHICQAPPCPRYAWRAEEWQE
CTKTCGEGSRYRKVLCVDAEKGSEVHGMHCDMSKRPADRESCTLQPCEYVWITGEWSECS
VTCGKGYKQRLVSCSEIYTGKENYEYSYQSTINCPGTQPPSVHPCYLRECPVSATWRVGN
WGSCSVSCGVGVTHRSVQCLTNEDQPSHLCSADLKPEERKTCHNIYHCELPQNCKEVKRL
EGTNKDGEYFLLIKGKLLKIFCAGMQSDHPKEYVTLVHTDSENFSEVYGHRLHNPTECPY
NGSRRDDCQCRKDYTAAGFSSFQKIRIDLTTMQIITTDLQFARTSEGHPVPFATAGDCYS
AAKCPQGRFSINLYGTGLSLTESARWISQGNYAVSDIKKSPDGTRVIGKCGGYCGKCTPS
SGTGLEVQIL
Download sequence
Identical sequences M3YZS1
ENSMPUP00000016832 XP_004738365.1.14098 ENSMPUP00000016832

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]