SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016877 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000016877
Domain Number 1 Region: 18-341
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 2.88e-79
Family Pancreatic carboxypeptidases 0.000000695
Further Details:      
 
Domain Number 2 Region: 341-421
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 1.73e-19
Family Carboxypeptidase regulatory domain 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016877   Gene: ENSMPUG00000016982   Transcript: ENSMPUT00000017127
Sequence length 471
Comment pep:novel scaffold:MusPutFur1.0:GL896923.1:5185683:5209837:1 gene:ENSMPUG00000016982 transcript:ENSMPUT00000017127 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGLLSVSFHLILLFKFVAPVTFRHHRYDELVRTLYRVHNECPYITRVYSIGRSVKGRHL
YVLEFSDYPGIHEPLEPEVKYVGNMHGNEALGRELLLQLAEFLCEEFRNGNQRIVRLLEG
TRVHILPSMNPDGYEVAAAQGADSSGYLVGRNNANGVDLNRNFPDLNTYIYYNEKHGGPN
HHLPLPDNWKSQVEPETQAVIQWIRSFNFVLSANLHGGAVVANYPYDRSLEHRVRGFRRT
ANTPTPDDKLFQKLAKVYSYAHGWMHQGWNCGDYFPDGITNGASWYSLSKGMQDFNYLHT
NCFEITLELSCDKFPRQEELQREWLGNREALIQFLEQVHQGIKGMVRDENYNNLAEAVIS
VSGINHDITSGDHGDYFRLLLPGTYTVTATAPGFDPETVTVTVGPGEPKLVNFHLKRSVP
QTTPPRRVPNSGHGGRGRLKHVQPQVSQEGGDGDDAAPESLPEVHSAGATW
Download sequence
Identical sequences M3YZW6
ENSMPUP00000016877 ENSMPUP00000016877

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]