SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016915 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000016915
Domain Number 1 Region: 17-265
Classification Level Classification E-value
Superfamily SET domain 1.42e-63
Family Histone lysine methyltransferases 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016915   Gene: ENSMPUG00000017021   Transcript: ENSMPUT00000017166
Sequence length 309
Comment pep:known scaffold:MusPutFur1.0:GL896899.1:27584904:27598966:1 gene:ENSMPUG00000017021 transcript:ENSMPUT00000017166 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRKAVERWPCEMAATEAPTERLDVACGLENVPVSAWPPGAEPEPFQYTPDHVAGPGTDV
DPTQITFPGCICLKTPCLPGTCSCLRRGENYDDESRLIDIGSEGKCAKPVFECNILCPCS
DHCRNRVVQRGLQFQLQVFKTDRKGWGLRTLELIPKGRFVCEYAGEVLGYSEVQRRIQLQ
TIHDPNYIIAIREHVHNGQVLETFVDPAHVGNIGRFLNHSCEPNLLMIPVRIDSMVPKLA
LFAAKDILPEEELSYDYSGRFLNLMDSEDKERLDPGKIRKPCYCDAKSCAAFLPYDSSLF
CPLEKPNIG
Download sequence
Identical sequences M3Z004
ENSMPUP00000016915 XP_012909457.1.14098 ENSMPUP00000016915

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]