SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016968 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000016968
Domain Number 1 Region: 411-468
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000144
Family TSP-1 type 1 repeat 0.005
Further Details:      
 
Domain Number 2 Region: 235-292
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000123
Family TSP-1 type 1 repeat 0.0053
Further Details:      
 
Domain Number 3 Region: 293-349
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000131
Family TSP-1 type 1 repeat 0.0043
Further Details:      
 
Domain Number 4 Region: 472-523
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000732
Family TSP-1 type 1 repeat 0.0045
Further Details:      
 
Domain Number 5 Region: 353-406
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000105
Family TSP-1 type 1 repeat 0.0055
Further Details:      
 
Domain Number 6 Region: 182-232
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000196
Family TSP-1 type 1 repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016968   Gene: ENSMPUG00000017076   Transcript: ENSMPUT00000017221
Sequence length 574
Comment pep:known scaffold:MusPutFur1.0:GL896963.1:1439118:1910188:-1 gene:ENSMPUG00000017076 transcript:ENSMPUT00000017221 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHKSNNYLALRSRSGRSIINGNWAIDRPGRYEGGGTMFTYKRPNEISSTAGESFLAEGPT
NEILDVYMIHQQPNPGVHYEYVIMGTNAISPQVPPHRRPGEPFNGQLGTDGRSQEEGAEK
EGAEEKEDVHGGAPEVFTSESAQTFPVRHPDGFSSHRPDNLVPAAPQPPRRSRDHNWKQL
GTTECSTSCGKGSQFPIFRCVHRNTHEEVPESYCDSSMKPTPEEEPCNLFPCPAFWDIGE
WSECSKTCGLGMQHRQVLCRQVYANRSLTVQPYRCQHLEKPETTSTCQLKICSEWQIRTD
WTSCSVPCGVGQRTRDVKCVSNIGDVVDDEECNMKLRPNDIENCDMGPCAKSWFLTEWSE
RCSAECGAGVRTRSVVCMTNHISSLPLEGCGNNRPAEATPCDNGPCTGKVEWFAGSWSQC
SIECGSGTQQREVICVRKNADIFEVLDPYECSFLEKPPSQQPCHLKPCGAKWFNTEWSMC
SKSCQGGFRVREVRCLSDDMTISNLCDPQLKPEEKESCNPQDCVPEVDENCKDRYYNCNV
VVQARLCVYNYYKTACCASCTRVANRQAGFLGSR
Download sequence
Identical sequences M3Z057
ENSMPUP00000016968 ENSMPUP00000016968

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]