SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016975 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000016975
Domain Number 1 Region: 299-357
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.17e-17
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 2 Region: 917-967
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.93e-17
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 3 Region: 264-313
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000394
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 4 Region: 342-394
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000993
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 5 Region: 957-1002
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000235
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 6 Region: 79-187
Classification Level Classification E-value
Superfamily SET domain 0.00000036
Family Histone lysine methyltransferases 0.085
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000016975
Domain Number - Region: 385-432
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00011
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Domain Number - Region: 206-233
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00835
Family Classic zinc finger, C2H2 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016975   Gene: ENSMPUG00000017083   Transcript: ENSMPUT00000017228
Sequence length 1212
Comment pep:novel scaffold:MusPutFur1.0:GL896952.1:2295342:2838683:-1 gene:ENSMPUG00000017083 transcript:ENSMPUT00000017228 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSKGRARKLATSNVCVYGSYPEIPLEEMSDADGVASTPSLNIQEPCSPATSSEAFTPKE
GSPYKAPIYIPDDIPIPAEFELRESNMPGAGLGIWTKRKIEAGEKFGPYVGEQRSNLKDP
SYGWELIDEFCNVKFCIDASQPDVGSWLKYIRFAGCYDQHNLVACQINDQIFYRVVADIA
PGEELLLFMKSEDYPHETMAPDIHEEQQYRCEDCDQLFESKAELADHQKFPCSTPHSAFS
MVEEDFQQKLESENDLQDIHAIQECKECDQVFPDLQSLEKHMLSHTEEREYKCDQCPKAF
NWKSNLIRHQMSHDSGKHYECENCAKVFTDPSNLQRHIRSQHVGARAHACPECGKTFATS
SGLKQHKHIHSSVKPFICEVCHKSYTQFSNLCRHKRMHADCRTQIKCKDCGQMFSTTSSL
NKHRRFCEGKNHFAAGGFFGQGISLPGTPAMDKTSMVNMSHANPGLADYFGANRHPAGLT
FPTAPGFSFSFPGLFPSGLYHRPPLIPASSPVKGLSSTEQTNKSQSPLMTHPQILPATQD
ILKALSKHPSVGDNKPVELQPERSSEERPLEKISDQSESSDLDDVSTPSGSDLETTSGSD
LESDIESDKEKFKENGKMFKDKVSPLQNLASIHNKKEYSNHSIFSPSLEEQTAVSGAVND
SIKAIASIAEKYFGSTGLVGLQDKKVGALPYPSMFPLPFFPAFSQSMYPFPDRDLRSLPL
KMEPKSPSEVKKLQKGSSESPFDLTTKRKDEKPLTPGPSKPPATPATSQDQPLDLSMGSR
SRASGTKLTEPRKNHVFGEKKGSNIEPRPPSDGSLQHARPTPFFMDPIYRVEKRKLTDPL
EALKEKYLRPSPGFLFHPQFQLPDQRTWMSAIENMAEKLESFSALKPEASELLQSVPSMF
NFRAPPNALPENLLRKGKERYTCRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSFSI
SSNLQRHVRNIHNKEKPFKCHLCDRCFGQQTNLDRHLKKHENGNMSGTATSSPHSELEST
GAILDDKEDAYFTEIRNFIGNSNHSGQSPRNTEERMNGSHFKDEKALVTSQNSDLLDDEE
VEDEVLLDEEDDDNDITGKTGKEPGTSNLHEGNPEDDYEDASTLEMSCKTSPVRYKEEEY
KTGLSALDHIRHFTDSLKMRKLEDNQYTEAELSSFSASHVPEELKQPLHRKSKSQQRQLL
TSGRSMQLNVIP
Download sequence
Identical sequences M3Z064
ENSMPUP00000016975 ENSMPUP00000016975

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]