SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000016999 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000016999
Domain Number 1 Region: 294-620
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.86e-90
Family Protein kinases, catalytic subunit 0.0000000614
Further Details:      
 
Domain Number 2 Region: 63-149
Classification Level Classification E-value
Superfamily CAD & PB1 domains 2.94e-28
Family PB1 domain 0.00000383
Further Details:      
 
Domain Number 3 Region: 165-235
Classification Level Classification E-value
Superfamily Cysteine-rich domain 2.24e-18
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000016999   Gene: ENSMPUG00000017108   Transcript: ENSMPUT00000017253
Sequence length 638
Comment pep:known scaffold:MusPutFur1.0:GL896952.1:3314372:3380168:1 gene:ENSMPUG00000017108 transcript:ENSMPUT00000017253 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDRWLRPPSPGMWAFGASEVGGTRAGRRAGPGRREEPRGSGCPGEATLGSAPRAEWTGGG
SGDHSHQVRVKAYYRGDIMITHFEPSISFEGLCSEVRDMCSFDNEQLFTMKWIDEEGDPC
TVSSQLELEEAFRLYELNKDSELLIHVFPCVPERPGMPCPGEDKSIYRRGARRWRKLYCA
NGHTFQAKRFNRRAHCAICTDRIWGLGRQGYKCINCKLLVHKKCHKLVTIECGRHSMPPE
PMMPMDQSSMHSDHAQTVIPYNPSSHESLDQVGEEKEAMNTRESGKASSSLGLQDFDLLR
VIGRGSYAKVLLVRLKKTDRIYAMKVVKKELVNDDEDIDWVQTEKHVFEQASNHPFLVGL
HSCFQTESRLFFVIEYVNGGDLMFHMQRQRKLPEEHARFYSAEISLALNYLHERGIIYRD
LKLDNVLLDSEGHIKLTDYGMCKEGLRPGDTTSTFCGTPNYIAPEILRGEDYGFSVDWWA
LGVLMFEMMAGRSPFDIVGSSDNPDQNTEDYLFQVILEKQIRIPRSLSVKAASVLKSFLN
KDPKERLGCHPQTGFADIQGHPFFRNVDWDMMEQKQVVPPFKPNISGEFGLDNFDSQFTN
EPVQLTPDDDDIVRKIDQSEFEGFEYINPLLMSAEECV
Download sequence
Identical sequences M3Z088
ENSMPUP00000016999 ENSMPUP00000016999

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]