SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017011 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017011
Domain Number 1 Region: 6-95
Classification Level Classification E-value
Superfamily PDZ domain-like 4.07e-25
Family PDZ domain 0.00027
Further Details:      
 
Domain Number 2 Region: 285-314
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000976
Family LIM domain 0.00093
Further Details:      
 
Domain Number 3 Region: 252-284
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000103
Family LIM domain 0.00078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017011   Gene: ENSMPUG00000017120   Transcript: ENSMPUT00000017265
Sequence length 329
Comment pep:known scaffold:MusPutFur1.0:GL896923.1:9293003:9338539:1 gene:ENSMPUG00000017120 transcript:ENSMPUT00000017265 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTQQIVLQGPGPWGFRLVGGKDFEQPLAISRVTPGSKAAIANLCIGDVITAIDGENTSS
MTHLEAQNKIKGCTDNMTLTVTRSEQKIWSPLVTEEGKRHPYKMNLASEPQEVLHIGSAH
NRSAMPFTASPASSSAPRVITNQYNNPAGLYSSENITNFNNALESKTAAGGQETNGRALD
HSQLPSGLVIDKESEVYKMLQEKQELNEPPKQSTSFLVLQEILESEEKGDPSKPSGFRSV
KAPVTKVAASIGNAQKLPMCDKCGTGIVGVFVKLRDRHRHPECYVCADCGTNLKQKGHFF
VEDQIYCEKHARERVTPPEGYDVVTVFPK
Download sequence
Identical sequences M3Z0A0
ENSMPUP00000017011 ENSMPUP00000017011 XP_004749685.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]