SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017028 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017028
Domain Number 1 Region: 5-128
Classification Level Classification E-value
Superfamily CAD & PB1 domains 3.92e-39
Family CAD domain 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017028   Gene: ENSMPUG00000017137   Transcript: ENSMPUT00000017282
Sequence length 238
Comment pep:novel scaffold:MusPutFur1.0:GL896899.1:32812760:32824849:-1 gene:ENSMPUG00000017137 transcript:ENSMPUT00000017282 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEYAMKSLSLLYPKSLSRHVAMSTSVVTQQLLSESSQEAPKARPCRVSTADRSVRKGIMA
HSLKDLLHKVRDTLMLADKPFLLVLEEDGTTVETEEYFQALADDTVFMVLQKGQKWQPPS
RPGTRHQLSLSCKPAKKIDVARVTFDLYKMNPQDFIGCLNVKATLYGTYSLSYNLHCYRA
KHIMKEVLRWALLSMQTTGHVLLGTSCYMQQLLDATEGGQPPESKAQSLIPACLKTLQ
Download sequence
Identical sequences M3Z0B7
ENSMPUP00000017028 ENSMPUP00000017028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]