SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017107 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017107
Domain Number 1 Region: 40-98
Classification Level Classification E-value
Superfamily Chromo domain-like 7.12e-18
Family Chromo domain 0.00033
Further Details:      
 
Domain Number 2 Region: 119-180
Classification Level Classification E-value
Superfamily Chromo domain-like 0.00000174
Family Chromo domain 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017107   Gene: ENSMPUG00000017215   Transcript: ENSMPUT00000017361
Sequence length 198
Comment pep:novel scaffold:MusPutFur1.0:GL896923.1:11058083:11062222:-1 gene:ENSMPUG00000017215 transcript:ENSMPUT00000017361 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CCQTSEHLNDSIIHYLIFSATNPSPVKKGKKEMERVKKLEEAEPVEFVVEKVLDHHVVNG
KGEYFLKWKGFTDADNTWEPGENLDCPELIEAFLISQNLVKKKIVYEADYSKSKKKRDVA
DEPRGFVRGLGPKQIICATDSSGKFKSLMNGKIQMRQEGSLNCNCFKTVIAFYKERLTWH
LYVMNRKTNKEEKKEKKK
Download sequence
Identical sequences M3Z0J5
ENSMPUP00000017107 ENSMPUP00000017107

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]