SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017213 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017213
Domain Number 1 Region: 36-195
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 8.63e-31
Family CRAL/TRIO domain 0.00048
Further Details:      
 
Domain Number 2 Region: 573-658
Classification Level Classification E-value
Superfamily PAH2 domain 2.88e-25
Family PAH2 domain 0.00000308
Further Details:      
 
Domain Number 3 Region: 395-464
Classification Level Classification E-value
Superfamily PAH2 domain 8.63e-24
Family PAH2 domain 0.0012
Further Details:      
 
Domain Number 4 Region: 735-802
Classification Level Classification E-value
Superfamily PAH2 domain 0.00000000000000484
Family PAH2 domain 0.011
Further Details:      
 
Domain Number 5 Region: 200-262
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 0.0000000000184
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0077
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000017213
Domain Number - Region: 1-31
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 0.00615
Family CRAL/TRIO N-terminal domain 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017213   Gene: ENSMPUG00000017323   Transcript: ENSMPUT00000017469
Sequence length 1550
Comment pep:known scaffold:MusPutFur1.0:GL896963.1:6426911:6550113:-1 gene:ENSMPUG00000017323 transcript:ENSMPUT00000017469 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARKFDVLRAIELFHSYRETRRKEGIVKLKPHEEPLRSEILSGKFTILNVRDPTGASIAL
FTARLHHPHKSVQHVVLQALFYLLDRAVDSFETQRNGLVFIYDMCGSNYTNFELDLGKKV
LNLLKGAFPARLKKVLIVGAPIWFRVPYSIISLLLKDKVRERIQILKTSEVTQHLPRECL
PENLDWDSVHVPGPHAMTIQELMDYVSTRQKRGIYEEYEDIRRENPVGTFHCSMSPGNLE
KNRYGDVPCLDQTRVKLTKRSGHTQVLWCIPEHERRMKRRLDDQESPVYAAQQRRIPGST
EAFPHQHRVLAPAPPVYEAVSETMQSATGIQYSVTPSYQVSAVPQSSGSHGPTIAAVHSS
HHHPAAVQPHGGQVVQSHAHPAPPVAPVQGQQQFQRLKVEDALSYLDQVKLQFGSQPQVY
NDFLDIMKEFKSQSIDTPGVISRVSQLFKGHPDLIMGFNTFLPPGYKIEVQTNDMVNVTT
PGQVHQIPTHGIQPQPQPPPQHPSQPSAQSAPAPAQPAPQPPPAKVSKPSQLQAHTPASQ
QTPPLPPYASPRSPPVQPHTPVTISLGTAPSLQNNQPVEFNHAINYVNKIKNRFQGQPDI
YKAFLEILHTYQKEQRNAKEAGGNYTPALTEQEVYAQVARLFKNQEDLLSEFGQFLPDAN
SSVLLSKTTAEKVDSVRNDHGGTVKKPQLNNKPQRPNQNGCQIRRHSGTGTTPPVKKKPK
LLSLKDSSMADASKHGVGTESLFFDKVRKALRSAEAYENFLRCLVIFNQEVISRAELVQL
VSPFLGKFPELFNWFKNFLGYKESVHLETFPKERATEGIAMEIDYASCKRLGSSYRALPK
SYQQPKCTGRTPLCKEVLNDTWVSFPSWSEDSTFVSSKKTQYEEHIYRCEDERFELDVVL
ETNLATIRVLEAIQKKLSRLSAEEQAKFRLDNTLGGTSEVIHRKALQRIYADKAADIIDG
LRKNPSIAVPIVLKRLKMKEEEWREAQRGFNKVWREQNEKYYLKSLDHQGINFKQNDTKV
LRSKSLLNEIESIYDERQEQATEDNAGIPVGPHLSLAYEDKQILEDAAALIIHHVKRQTG
IQKEDKYKIKQIMHHFIPDLLFAQRGDLSDVEEEEEEEMDVDEATGAAKKHNGVGGSPPK
SKLLFSNTAAQKLRGMDEVYNLFYVNNNWYIFMRLHQILCSRLLRICSQAERQIEEENRE
REWEREVLGIKRDKSDSPAIQLRLKEPMDVDVEDYYPAFLDMVRSLLDGNIDSSQYEDSL
REMFTIHAYIAFTMDKLIQSIVRQLQHIVSDEICVQVTDLYLAENNNGATGGQLNTQTSR
SLLESTYQRKAEQLMSDENCFKLMFIQSQGQVQLTIELLDTEEENSDDPVEAERWSDYVE
RYMNSDTTSPELREHLARKPVFLPRNLRRIRKCQRGREQQEKEGKEGNSKKTMENVDSLD
KLECRFKLNSYKMVYVIKSEDYMYRRTALLRAHQSHERVSKRLHQRFQAWVDKWTKEHVP
REMAAETSKWLMGEGLEGLVPCTTTCDTETLHFVSINKYRVKYGAAFKAP
Download sequence
Identical sequences M3Z0V1
ENSMPUP00000017213 ENSMPUP00000017213

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]