SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017224 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017224
Domain Number 1 Region: 6-288
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.61e-70
Family FCH domain 0.0024
Further Details:      
 
Domain Number 2 Region: 353-412
Classification Level Classification E-value
Superfamily SH3-domain 5.38e-22
Family SH3-domain 0.00089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017224   Gene: ENSMPUG00000017334   Transcript: ENSMPUT00000017480
Sequence length 413
Comment pep:known scaffold:MusPutFur1.0:GL896963.1:7528614:7575940:-1 gene:ENSMPUG00000017334 transcript:ENSMPUT00000017480 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMPQLQFRDAFWCRDFTAHTGYEVLLQRLLDGRKMCKDVEELLRQRAQAEERYGKELVQI
ARKAGGQTEINSLRASFDSLKQQMENVGSSHIQLALALREELRSLEEFRERQKEQRKKYE
AVMDRVQKSKLSLYKKAMDSKKSYEQKCRDADDAEQAFERISTNGPQKQVEKSQNKAKQC
KDSAMEAERVYKQNIEQLEKVRGEWEQEHRTTCEAFQLQESDRLTILRNAMWVHCNQLSL
QCVKDDELYEEVRVTLEGCSVEADIDGFIQAKTTGTEPPAPVPYQNYYDREVTPSSGSPG
VQPSCGMIKRFSGLLHGSPKTISLAASAETLTPMPEHNEVVYSSIAVKEAPGPPTLPAQG
YRVLYDYTAQNSDELDISAGDILEVILEGEDGWWTVERNGQRGFVPGTYLEKL
Download sequence
Identical sequences M3Z0W2
XP_012914865.1.14098 ENSMPUP00000017224 ENSMPUP00000017224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]