SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017237 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017237
Domain Number 1 Region: 178-249
Classification Level Classification E-value
Superfamily Homeodomain-like 5.56e-18
Family Homeodomain 0.0000547
Further Details:      
 
Domain Number 2 Region: 54-120
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.14e-16
Family LIM domain 0.022
Further Details:      
 
Domain Number 3 Region: 22-52
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000015
Family LIM domain 0.018
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000017237
Domain Number - Region: 117-143
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00304
Family LIM domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017237   Gene: ENSMPUG00000017347   Transcript: ENSMPUT00000017493
Sequence length 359
Comment pep:novel scaffold:MusPutFur1.0:GL896963.1:8172572:8178217:-1 gene:ENSMPUG00000017347 transcript:ENSMPUT00000017493 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDIIFHYPFLGAMGDHSKKKPGTAMCVGCGSQIHDQFILRVSPDLEWHAACLKCAECSQ
YLDETCTCFVRDGKTYCKRDYVRLFGIKCAKCQVGFSSSDLVMRARDSVYHIECFRCSVC
SRQLLPGDEFSLREHELLCRADHGLLLERAAAGSPRSPGPLPGARGLHLPDPGSGRQPSL
RPHVHKQTEKTTRVRTVLNEKQLHTLRTCYAANPRPDALMKEQLVEMTGLSPRVIRVWFQ
NKRCKDKKKSILMKQLQQQQHNDKTSLQGLTGTPLVAGSPIRHESAVQGSAVEVQTYQPP
WKALSEFALQSDLDQPAFQQLVSFSESGSLGNSSGSDVTSLSSQLPDTPNSMVPSPVET
Download sequence
Identical sequences I3M715 M3Z0X5
ENSSTOP00000005338 ENSMPUP00000017237 XP_004414623.1.74151 XP_004611813.1.94378 XP_004758545.1.14098 XP_005316895.1.77405 XP_015335698.1.40921 ENSSTOP00000005338 ENSMPUP00000017237

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]