SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017317 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017317
Domain Number 1 Region: 247-317
Classification Level Classification E-value
Superfamily SAM/Pointed domain 6.73e-17
Family SAM (sterile alpha motif) domain 0.00024
Further Details:      
 
Domain Number 2 Region: 153-234
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000236
Family SH3-domain 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017317   Gene: ENSMPUG00000017427   Transcript: ENSMPUT00000017573
Sequence length 380
Comment pep:novel scaffold:MusPutFur1.0:GL897257.1:365244:377621:1 gene:ENSMPUG00000017427 transcript:ENSMPUT00000017573 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRRKPSNASDKEPTQKRKLSLQRSSSFKDFAKSKPGSPVVSEKEFNLDENIPEDESGVP
TPEDAGKSGKKLGKKWRAVISRTMNRKMGKMMVKALSEEMGDTLEEGSNSPTSPDCSLDS
PSPEKMALAFSEQEERELPALSRQASTGSELCSPSPGSGSFGEEAPAPQYTGPFCGRARV
HTDFTPSPYDHDSLKLQKGDVIQIIEKPPVGTWLGLLNGRLGSFKFIYVDVLPEEAVGPA
RPSRRQSKGKRPKPKTLHELLERIGLEEHTSTLLLNGYQTLEDFKELRETHLNELNIMDP
QHRAKLLTAAELLLDYDTGSEEAEEGAESSQEPVANTVSEPKVDIPRDSGCFEGSESGRD
EAELAGAEEQLHGLSLAGAP
Download sequence
Identical sequences M3Z155
ENSMPUP00000017317 XP_004780595.1.14098 ENSMPUP00000017317

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]