SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017452 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017452
Domain Number 1 Region: 309-544
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.7e-54
Family DBL homology domain (DH-domain) 0.0000381
Further Details:      
 
Domain Number 2 Region: 544-668
Classification Level Classification E-value
Superfamily PH domain-like 3.56e-31
Family Pleckstrin-homology domain (PH domain) 0.0029
Further Details:      
 
Domain Number 3 Region: 115-179
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000224
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017452   Gene: ENSMPUG00000017564   Transcript: ENSMPUT00000017710
Sequence length 1151
Comment pep:novel scaffold:MusPutFur1.0:GL897088.1:1216670:1289050:-1 gene:ENSMPUG00000017564 transcript:ENSMPUT00000017710 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPARRVSFSVRISPHLLKSKTLFFPGSSYSSDEEEELPNSRPFHGTSANLTESITEETY
SFLPQSPSKKDFEGKSGTKVSRTFSYIKNKMSSSKKSREKEKEKEKIKEKEKDLKEKEKD
KKTVNGHTFSSIPVVGPISCSQCVKPFTSKDAYTCAGCGAFVHKGCRESLASCAKVKMKQ
PRGSLQAQDTSSLPTVIMRSKPSQPKERPRSAVLLADEAAAIPMFANRRSQQSVSLSKSV
SIQNIAGVGNDENISNTWKFLSHSTDSLNKISKVNESTESLTDEGVGTDMNEGQLMGDFE
MESKQLEAESWSRIVDSKFLKQQKKDVVKRQEVIYELMQTELHHIRTLKIMSDVYSRGMM
TELLFEQQTVEKLFPCLDELISIHSQFFQRILERKKESLVDKSEKNFLIRRMGDVLVNQF
SGENAERLKKTYGKFCGQHNQSVNYFKDIYTKDKRFQAFVKKKMSSAVVRRLGIPECILL
VTQRITKYPVLFQRILQCTKDNDVEQEDLAQSVSLVKDVIGAVDSKVASYEKKVRLNEIY
TKTDSKSIMRMKSGQMFAKEDLKRKKLVRDGGVFLKSATGRLKEVQAVLLTDILVFLQEK
DQKYVFASLDQKSTVISLKKLIVREVAHEEKGLFLISMGMKDPEMVEVHASSKEERNSWI
HIIQDTINTLNRDEDEGIPSENEEEKRLQDTKARELKEQLQQKDQQILLLLEEKEMIFRD
MTECSTPLPEDCSPTHSSRILFRSNTEEALKGGPLMKSAINEVEILQGLVSGSLGGTLGP
AVSSPVEQEGMVGPVSLPRRAETFGGFDSHQMNASKGGEKEEGEDGQDLRRTESDSGLKK
GGNANLVFMLKRNSEQVIQSVVHLHELLSALQGVVLQQDSYIEDQKLLLAERALTRSSSR
PSSLVEQEKQRSLEKQRQDLANLQKQQAQHLEEKRRREREWEARERALQEREARLAQREQ
DVRRGQQDLEREHDELQLRKGAYQCDLERLRAAQRQLEREQEQLRRDTERLSQRQAEHDA
QQVSQQHRKLLRIPSFLPSPEEPPLPPVPSVAKSGSLDSELSVSPKRNSISRTHKDKGPF
HILSSTSQPARGPEGQSQTPAPAPAPASTRLFGLAKPKEKKEKKKKNKGGRSQPGEGPMS
EVPTEGEEIFC
Download sequence
Identical sequences M3Z1J0
ENSMPUP00000017452 ENSMPUP00000017452

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]