SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017457 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017457
Domain Number 1 Region: 18-66
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000968
Family TSP-1 type 1 repeat 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017457   Gene: ENSMPUG00000017570   Transcript: ENSMPUT00000017716
Sequence length 209
Comment pep:novel scaffold:MusPutFur1.0:GL896916.1:2614357:2624364:-1 gene:ENSMPUG00000017570 transcript:ENSMPUT00000017716 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLETIQPSPTPPSLPVVSCVVAEWSGWSCCVKPCQISYRVRRRRVLQEPRNGGAPCPPL
EERAGCVDYWSRQGVECQQSLIPALITTDSYGKERKKRGVPKKQETAGHDAEYCVQFQLG
PVPGSCRQVKAPHAQWTRYLTQGHTICVRCEWPAQDARSRRCYGDGAGTGGNQRLRWQAA
GHPQCRGTWMRLRQLRDCSCPEVHSLVFL
Download sequence
Identical sequences M3Z1J5
ENSMPUP00000017457 ENSMPUP00000017457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]