SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017478 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017478
Domain Number 1 Region: 40-259
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.96e-60
Family DBL homology domain (DH-domain) 0.0000164
Further Details:      
 
Domain Number 2 Region: 245-391
Classification Level Classification E-value
Superfamily PH domain-like 2.36e-34
Family Pleckstrin-homology domain (PH domain) 0.00061
Further Details:      
 
Domain Number 3 Region: 505-636
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 3.48e-32
Family DEP domain 0.0012
Further Details:      
 
Domain Number 4 Region: 408-522
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.34e-27
Family DEP domain 0.0036
Further Details:      
 
Domain Number 5 Region: 623-705
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000146
Family PDZ domain 0.026
Further Details:      
 
Domain Number 6 Region: 709-773
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000024
Family PDZ domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017478   Gene: ENSMPUG00000017591   Transcript: ENSMPUT00000017737
Sequence length 1648
Comment pep:novel scaffold:MusPutFur1.0:GL896916.1:3037928:3215896:1 gene:ENSMPUG00000017591 transcript:ENSMPUT00000017737 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGPGGSDPSGDGAGDGAHPDPRVPGAAAPSSGPCAAARESERQLRLRLCVLNEILGTER
DYVGTLRFLQSAFLHRIRQNVADSVEKGLTEENVKVLFSNIEDILEVHKDFLAALEYCLH
PEPQSQHELGNVFLKFKDKFCVYEEYCSNHEKALRLLVELNKIPTVRAFLLSCMLLGGRK
TTDIPLEGYLLSPIQRICKYPLLLKELAKRTPGKHPDHPAVQSALQAMKTVCSNINETKR
QMEKLEALEQLQSHIEGWEGSNLTDICTQLLLQGTLLKISAGNIQERAFFLFDNLLVYCK
RKSRVTGSKKSTKRTKSINGSLYIFRGRINTEVMEVENVEDGTADYHSNGYTVTNGWKIH
NTAKNKWFVCMAKTAEEKQKWLDAIIREREQRESLKLGMERDAYVMIAEKGEKLYHMMMN
KKVNLIKDRRRKLSTVPKCFLGNEFVTWLLEIGEISKTEEGVNLGQALLENGIIHHVSDK
HQFKNEQVMYRFRYDDGTYKARSELEDIMSKGVRLYCRLHSLYTPVIKDRDYHLKTYKSV
LPGSKLVDWLLAQGDCQTREEAVALGVGLCNNGFMHHVLEKSEFKDESQYFRFHADEEME
GTSSKNKQLRNDFKLVENILAKRLLILPQEEDYGFDIEEKNKAVVVKSVQRGSLAEMAGL
QVGRKIYSINEDLVFLRPFAEVESILNQSFCSRRPLRLLVATKAKEIIKVPDHPEALCFQ
IRGAAPPCIYAVGRGSEAAAAGLCAGQCILKVNGNNVVNDGAQEVLEHFQAFRNHQEEAL
GLYQWVYHTHEDAQEARASQEAPGEDPQSDSAFPLMSLGPQLSLHEDSPVVTLTVDNVHL
EHGVVYEYVSTAGVKCHVLEKIVEPRGCFGLAAKILKAFAADDSVFVQNCGRLMALNNSI
KTMSHYEFRNICDTKLESIGQRIACYQEFAAQLKSRVSPPFKQASPEPHPLCGLDFCPTN
CHVNLMEVSYPKTTPSVGRSFSIRFGRKPSLIGLDPEQGHLNPMSYTQHCITTMAAPSWK
CLPAADGDLQQQGLNDSGFGSASETASQEDRGLSFLLKQEDREIQGAYRQLFTKLDVALK
EMKQYVTQINRLLSTITEPTSGVSCDPPLAEEASSPPLVSDESEMDRADHGGIKKVCFKV
SEEEQEDSGHDTMSYRDSYSECNSNRDSVLSYTSVRSNSSYLGSDEMGSGDELPCDMRIP
SDKQDKLHGCLEHLFNQVDSIHALLKGPVMSRAFEETKHFPMDHSLQEFKQKEEGTIRGR
SLIQISIQEDPWNLPNSIKTLVDNIQRYVEDGKNQLLLALLKCTDTELQLRRDAVFCQAL
VAAVCTFSEQLLAALSFRYNNNGEYEDSSRDASRKWLEQVAATGVLLHCQSLLSPAAVKE
ERTMLEDIWVTLSELDNVTFSFKQLDENYVANTSVFYHIEGSRQALRVVFYLDSYHFSKL
PSRLEGGASLRLHTVLFTRALENVEGLPPPGSQAAEDLQQEINAQSLEKVQQYYRKLRAF
YLERSNLPTDASTTAVKIDQLIRPINALDELCRLMKSFVHPKPGASGSLGAGLIPISSEL
CYRLGACQIAMCGTGMQRSTLSVSLEQAAILARSHGLLPKCIMQATDIMRKQGPRVEILA
KNLRVKDQMPQGAPRLYRLCQPPVDGDL
Download sequence
Identical sequences M3Z1L6
ENSMPUP00000017478 ENSMPUP00000017478 XP_004746301.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]