SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017504 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017504
Domain Number 1 Region: 129-241
Classification Level Classification E-value
Superfamily PX domain 2.49e-21
Family PX domain 0.00094
Further Details:      
 
Domain Number 2 Region: 213-332
Classification Level Classification E-value
Superfamily TPR-like 0.00000000184
Family Tetratricopeptide repeat (TPR) 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017504   Gene: ENSMPUG00000017617   Transcript: ENSMPUT00000017763
Sequence length 371
Comment pep:novel scaffold:MusPutFur1.0:GL896916.1:5408218:5412727:-1 gene:ENSMPUG00000017617 transcript:ENSMPUT00000017763 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SGSPQGAMASRLLHRLRHALAGDNPGEAATGPEAEQFPESSELEDDDAEGLSSRLSGTLS
FTSAEDEEEEDDEDDGEVGPDSLPSGDGASGEDADRSSPPDGQRGSQPLARQLQDFWKKS
RNTLVPQRLLFEVTSANVVKDPPSKYVLYTLAVMGPGPPDRQPAQISRRYSDFERLHRNL
QRQFRGPMAAISFPRKRLRRNFTAETIARRSRAFEQFLSHLQAVPELRRAPDLQDFFVLP
ELRRAQSLTCTGLYHEALALWANAWQLQTQLGTPLGPDRPLLTLAGLAVCHQELENPGEA
RACCERALQLLGDKNPHPLLAPFLEAHVRLSWRLGLDKRQTEARLQALQEAGLTPTPPPS
LKELLIKEELD
Download sequence
Identical sequences M3Z1P2
ENSMPUP00000017504 ENSMPUP00000017504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]