SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017505 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017505
Domain Number 1 Region: 8-156
Classification Level Classification E-value
Superfamily EF-hand 3.73e-48
Family Calmodulin-like 0.000000505
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017505   Gene: ENSMPUG00000017618   Transcript: ENSMPUT00000017764
Sequence length 160
Comment pep:known scaffold:MusPutFur1.0:GL896916.1:5417880:5423901:1 gene:ENSMPUG00000017618 transcript:ENSMPUT00000017764 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDQQAEARSYLSEEMIAEFKAAFDMFDADGGGDISVKELGTVMRMLGQTPTKEELDAII
EEVDEDGSGTIDFEEFLVMMVRQMKEDAKGKSEEELAECFRIFDRNADGYIDAEELAEIF
RASGEHVTDEEIESLMKDGDKNNDGRIDFDEFLKMMEGVQ
Download sequence
Identical sequences A0A1U7RDR7 A0A250XVE9 A0A2K5CAL4 F7HKV1 I3M816 M3Z1P3 P02586 Q304F3
ENSRNOP00000020348 ENSOPRP00000013046 ENSMPUP00000017505 ENSPVAP00000000342 ENSOPRP00000013046 ENSCJAP00000031973 ENSEEUP00000009740 NP_001032428.1.100692 NP_001032428.1.4139 XP_002747643.1.60252 XP_003983472.1.62641 XP_004405303.1.74151 XP_004405304.1.74151 XP_004469919.1.11602 XP_004746384.1.14098 XP_005085053.1.91757 XP_005325314.1.77405 XP_005362964.1.66349 XP_005392466.1.28644 XP_006921925.1.64745 XP_006971046.1.50099 XP_008835986.1.79516 XP_011367630.1.92234 XP_012322726.1.9421 XP_016007860.1.101085 XP_016820462.1.28591 XP_016832220.1.69978 XP_019313875.1.44245 XP_020023613.1.5219 XP_543023.2.84170 ENSEEUP00000009740 ENSSTOP00000005816 9685.ENSFCAP00000001745 ENSCJAP00000031973 ENSPVAP00000000342 ENSMPUP00000017505 ENSSTOP00000005816 ENSDNOP00000032593 ENSFCAP00000001745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]