SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017551 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017551
Domain Number 1 Region: 28-103
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000154
Family Growth factor receptor domain 0.0031
Further Details:      
 
Domain Number 2 Region: 190-237
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000106
Family TSP-1 type 1 repeat 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017551   Gene: ENSMPUG00000017663   Transcript: ENSMPUT00000017810
Sequence length 250
Comment pep:novel scaffold:MusPutFur1.0:GL896916.1:6310029:6323167:-1 gene:ENSMPUG00000017663 transcript:ENSMPUT00000017810 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGTPQTHLLAFSLLCLLSKVCAQLCPTPCACPWPPPRCPLGVPLVLDGCGCCRVCARRL
GEPCDHLHVCDPSQGLVCRPRVGSGYRGAVCLWGEDDGSCEVNGRLYRDGETFQPHCRIR
CQCEDGGFTCVPLCSEDVRLPSWDCPHPRRVEVPGKCCPEWVCDQGRELGVRPLPAQGPQ
FSGLVAPPPPGAPCPEWSTAWGPCSTTCGLGVATRVSNQNLLCRLETQRRLCLLGPCPPA
RGRGPRNSTF
Download sequence
Identical sequences M3Z1T9
XP_004746434.1.14098 ENSMPUP00000017551 ENSMPUP00000017551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]