SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017556 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017556
Domain Number 1 Region: 122-300
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 5.89e-50
Family CRAL/TRIO domain 0.0000381
Further Details:      
 
Domain Number 2 Region: 40-118
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 1.44e-20
Family CRAL/TRIO N-terminal domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017556   Gene: ENSMPUG00000017668   Transcript: ENSMPUT00000017815
Sequence length 342
Comment pep:known scaffold:MusPutFur1.0:GL896916.1:6529998:6541184:-1 gene:ENSMPUG00000017668 transcript:ENSMPUT00000017815 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEESDSLRTSPSAASLSENELPPPAEPPGYVCSLTEDLVTKAREELQEKPEWRLRDVQA
LRDMVRKECPNLSTSLDDAFLLRFLRARKFDYDRALQLLVSYHSCRRSWPEVFNNLKPSA
LKDVLASGFLTVLPHTDPRGCHILCMRPDRWIPSNYPITENIRAIYLTLEKLIQSEETQV
NGIVILADYKGVSLSKASHFGPFIAKKVIGILQDGFPIRIKAVHVVNEPRIFKGIFAIIK
PFLKEKIANRFFLHGSDLNSLHTSLPRSILPKEYGGTAGELDISAWNAVLLASEEDFVRE
FCQPVSVCDSILGQALPPEGLTSDAQCDDSLRAVKSQLYSCY
Download sequence
Identical sequences M3Z1U4 U6CVA2
ENSMPUP00000017556 ENSMPUP00000017556 XP_004746442.1.14098 XP_004746443.1.14098 XP_004746444.1.14098 XP_012908728.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]