SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017601 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017601
Domain Number 1 Region: 88-360
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.6e-76
Family Protein kinases, catalytic subunit 0.0000231
Further Details:      
 
Domain Number 2 Region: 15-86
Classification Level Classification E-value
Superfamily SH3-domain 1.44e-19
Family SH3-domain 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017601   Gene: ENSMPUG00000017712   Transcript: ENSMPUT00000017860
Sequence length 936
Comment pep:known scaffold:MusPutFur1.0:GL897126.1:762628:779419:-1 gene:ENSMPUG00000017712 transcript:ENSMPUT00000017860 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEEEGGTAKEWGTTPTGPVWTAVFDYEAAGDEELTLRRGDRVQVLSQDCAVSGDEGWWT
GQLPSGRVGVFPSNYVAPGAPAAPAGLQLPQEIPFHELQLEEIIGVGGFGKVYRALWRGE
EVAVKAARLDPERDPAVTAEQVRQEARLFGALKHPNIIALRGACLSPPHLCLVMEYARGG
ALSRVLAGRRVPPHVLVNWAVQVARGMNYLHNDAPVPIIHRDLKSINILILEAIENHNLA
DTVLKITDFGLAREWHKTTKMSAAGTYAWMAPEVIRLSLFSKSSDVWSFGVLLWELLTGE
VPYREIDALAVAYGVAMNKLTLPIPSTCPEPFARLLEECWDPDPHGRPDFGSILKRLEVI
EQSALFQMPLESFHSLQEDWKLEIQHMFDDLRTKEKELRSREEELLRAAQEQRFQEEQLR
RREQELAEREMDIVERELHLLMCQLSQEKPRVRKRKGNFKRSRLLKLREGGSHISLPSGF
EHKITVQASPTLDKRKGSDGASPPASPSIIPRLRAIRLTPVDGGGSSSGSSGGGSGTWGR
SGPPKKEELVGGKKKGRTWGPSSTLQKERAGGEERLKALGEGSKQWSSSAPNLGKSPKHT
PIAPGFASLNEMEEFAEADGGNSVPPSPYTTPSYLTVPLPAEPSPGAPAPLSRPGHGGRR
RCELALLGCATLLGAVGLGADVAEARAADCEEQRRWLDGLFPRAGRFPRGLSPPGRSPGR
RDDAASGPGLAPSATLVSLSSVSDCNSTRSLLRSDSDEAAPAAPSPPPSPPSTNPLVDLE
LESFKKDPRQSLTPTHVTAARAVSRGHRRTPSDGALGQRGVPEPAAPRPGPRDPLDFPRL
PDPQTLFPTHRRPPEFPGRPTTLTFAPRPRPAASRPRLDPWKLVSFGRTLGISPPSRPDT
PESPGLPGMQPTLLDMDMEGQSQDSTVPLCGAHGSR
Download sequence
Identical sequences M3Z1Y9
XP_004776198.1.14098 ENSMPUP00000017601 ENSMPUP00000017601

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]