SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017632 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017632
Domain Number 1 Region: 79-259
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 7.14e-53
Family F-box associated region, FBA 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017632   Gene: ENSMPUG00000017744   Transcript: ENSMPUT00000017892
Sequence length 262
Comment pep:known scaffold:MusPutFur1.0:GL897126.1:1290444:1293301:-1 gene:ENSMPUG00000017744 transcript:ENSMPUT00000017892 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEESDRHALGGGMEADEPASPQEPPSPPPPPSPPSPAAPDTPGTPQPEQPTEAYARQLL
LEEWRPPGGSLELPPRLTWKLLFLRRPLYRNLLRSPNPEGINIYEPAPPTGPTQQPLETL
GNFRGWYIRTEKLQHDRSWTVKQQCVDLLAEGLWEELLDDEQPDITVMDWYEDSRLDTCV
YELHVWLLAADRRSVIAQHHVAPRSSGRGPPGCWLQVSHVFRQYGPGVRFVHFLHKTKNQ
REPGGLRRTRVTDSSVSVQFRE
Download sequence
Identical sequences M3Z220
ENSMPUP00000017632 XP_004776244.1.14098 ENSMPUP00000017632

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]