SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017636 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017636
Domain Number 1 Region: 31-209
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.38e-74
Family F-box associated region, FBA 0.00000854
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017636   Gene: ENSMPUG00000017748   Transcript: ENSMPUT00000017896
Sequence length 213
Comment pep:novel scaffold:MusPutFur1.0:GL897126.1:1407069:1414776:1 gene:ENSMPUG00000017748 transcript:ENSMPUT00000017896 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WLLILARDHGSLLPLARSCLPPTRDGRPCLLGRFCERRPIGRNLIRNPCGQEGLRKWMVQ
HGGDGWVVEVNRSTVPGAPSQTCFVSSFSWCRKKQVLDLEEEGLWPELLDSGKIEICVSD
WWGARHDSGCMYRLLVQLLDANQTVLDKFSAMPVPIQQWNNNVCFQVTHVFSNIKMGVRF
VSFEHWGQDTQFWAGHYGARVTNSSVVVRAQLS
Download sequence
Identical sequences M3Z224
ENSMPUP00000017636 XP_004776328.1.14098 ENSMPUP00000017636

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]