SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017644 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMPUP00000017644
Domain Number - Region: 568-708
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.0196
Family CRAL/TRIO domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017644   Gene: ENSMPUG00000017756   Transcript: ENSMPUT00000017904
Sequence length 1189
Comment pep:known scaffold:MusPutFur1.0:GL896916.1:11768164:11805977:1 gene:ENSMPUG00000017756 transcript:ENSMPUT00000017904 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPPSLDAAIQHALAGLYPPFEATAPTILGQVFRLLDSDFQGDGLTCLLDFLIPAKRLCE
QVREAACAPYSHCLFLHEGWPLCLGGEVVVHLAPLNPLLLRQGDFYLQVEPQEEQSVCIM
IKCLSLDLRTVDTKPVPVSSYPILFTQTGLETINSDFEGSPLHNCLVASEDGIVSVPWTK
ITSPEFVDDRPQAVNVLSLAWGSLQLEALDLSCPPEPPQPKSPGCQELHAQSLAKGKGRT
YGNKYPGLIKVEPARPGEVAFRMDHVASQDLEGDYVVLLESRGGSPSREVETSHGCPLGA
SEELSRTKQIPFSQRTPPLSGTSGGPSLKKWACEKAASSEEEPCILDLRRKINHKVDSHT
HDSEQQPREPYLNVLEKPLPWASGLEAGGSEDLASSTKVQGHLANPENMVHPRPDPKQES
SLYLCPASSPATPVEERAKLRLSKPGPGPSQNTSSSRSPTPGLRFSFLKGQRQAPEPPEK
ASLQHDGPWKVLCSLYSPKPNRAKGLGKAGTTQTKASGPAADSGPLTRKKVGFPEGPPGR
VPAVDEETPGPEPRMGALSVELFQSRIACLPGGRDRAGRPLLLVSTTEGAWEAPWCTSSE
VTKLLSYLCTVPRPEDKTKGLAVVIDARKQPPHPGLVSALQVTQALAPASMGAVLYLGDE
EAALQPGMLPDIQVEVVTSLKALGHHVDPSQLPPALEGSLPYCHCEWVQFFQKLDPFLAD
LRRAASLLKASINQIEKSEPPGGVQEASRCLSKSKELMEAVLRDPGLLGLQREGGATLAK
LQQEAGRLDSNPDVRSHLAEAVALYGLVDERLHVLVSASNHLLGRLELRIRLGRLEAAIL
QVSNWMEQEGSRCLQALTPKDRSLETVEKAHMEFEDFFLHAAAQYRRGLELSKQAAELGA
TARGSSAAGGAEFPELAAFASTQRAFQAKLTHFYMAAERQRTDLETLLHLHLFCKKMTWF
HTDCQDLMRQLRLGKAQRASPGDQRRLDRYRQRLALEFPAEKLTAMGLQVASLSQEGLGQ
DLWEEARVRHEEIQTLLKKALAHCPCPEGPKARSAPPEVRRAAPKGQGPNGDVASRGRWG
LPPSDLPGLDHLPNPCWPRAHREGQNRNVKVGFLPQEAGRAVEAEEGKGPQEPFWFPAPE
PFFDPLFSRQRLLRQSKTPHPTGGSFSSEGTDSQTSLEDSPQTSPPASR
Download sequence
Identical sequences M3Z232
ENSMPUP00000017644 ENSMPUP00000017644 XP_004746507.1.14098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]