SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017854 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017854
Domain Number 1 Region: 80-308
Classification Level Classification E-value
Superfamily Fibrinogen C-terminal domain-like 1.7e-91
Family Fibrinogen C-terminal domain-like 0.000000483
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017854   Gene: ENSMPUG00000017965   Transcript: ENSMPUT00000018115
Sequence length 312
Comment pep:novel scaffold:MusPutFur1.0:GL897143.1:807361:837520:1 gene:ENSMPUG00000017965 transcript:ENSMPUT00000018115 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVKMVSFILVTTFLVMGMESWALENCLQEQARLRAQVRLLETRVKQQQVKITRLLHEKEI
QFLDKGEENTVIDLGGRRQYADCSEIFNDGYKRSGFYKIKPLQSPTIFSVYCDMSDGGGW
TVIQRRSDGSENFNRGWNDYENGFGNFVRENGEYWLGNKNLHLLTTQGDYTLKIDLADFE
KNSRYAQYKLFKVGDEKNSYELNIGEYSGTAGDSLGRNLHPEVQWWGSHQRMKFSTRDRD
NDNYEGNCAEEDRSGWWFNRCHSANLNGLYYTGSYTAKTDNGIVWHTWHGWWYSLKAVVM
KIRPNDFIPNTV
Download sequence
Identical sequences M3Z2P2
XP_004777497.1.14098 ENSMPUP00000017854 ENSMPUP00000017854

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]