SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017859 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017859
Domain Number 1 Region: 123-507
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 5.09e-146
Family Myotubularin-like phosphatases 0.000000036
Further Details:      
 
Domain Number 2 Region: 8-114
Classification Level Classification E-value
Superfamily PH domain-like 1.14e-16
Family GRAM domain 0.055
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000017859
Domain Number - Region: 524-566
Classification Level Classification E-value
Superfamily Prefoldin 0.0523
Family Prefoldin 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017859   Gene: ENSMPUG00000017970   Transcript: ENSMPUT00000018120
Sequence length 660
Comment pep:known scaffold:MusPutFur1.0:GL897143.1:1272457:1377797:1 gene:ENSMPUG00000017970 transcript:ENSMPUT00000018120 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEHIRTPKVENVRLVDRISSKKAALGTLYLTATHVIFVENAPDTRKETWILHSQISTIEK
QATTATGCPLLIRCKNFQLLQLIIPQERDCHDVYISLIRLARPVKYEELYCFSFNPKLDK
EAREQGWMLIDLGEEYKRMGLPSNYWQLSDVNRDYRVCDSYPTELYVPKSATAHIIVGSS
KFRSRRRFPALSYYYKDNHASICRSSQPLSGFSARCLEDEQMLQAIRKANPGSDFIYVVD
TRPKLNAMANRAAGKGYENEDNYSNIKFQFIGIENIHVMRSSLQKMLEVCELKSPSMSDF
LWGLENSGWLRHIKAIMDAGIFIAKAVSEEGASVLVHCSDGWDRTAQVCSVASLLLDPHY
RTLKGFMVLIEKDWISFGHKFNHRYGNLDGDPKEISPVIDQFIECVWQLMEQFPCAFEFN
ERFLIHIQHHIYSCQFGNFLCNSQKERQELKIQERTYSLWAHLWKNRADYLNPLFRADQS
QTRGTLRLPTTPCNFMYKFWNGMYNRFEKGLQPRQSVTDYLMAVKEETQQLEEELEALED
RLEKIQKVQLNHTKVKSKQSEPSKHSGFSTSDNSTANTPQDYSGNMKSFPSRSPSQGDED
SALILTQDNLKSSDPDLSANSDQESGVEDLSCRSPSGGECAPSEDSGKDRDSDEAVFLTA
Download sequence
Identical sequences M3Z2P7
XP_004777506.1.14098 ENSMPUP00000017859 ENSMPUP00000017859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]