SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017918 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017918
Domain Number 1 Region: 349-405,434-638
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 2.03e-40
Family PhyH-like 0.079
Further Details:      
 
Domain Number 2 Region: 65-178
Classification Level Classification E-value
Superfamily ARID-like 2.09e-30
Family ARID domain 0.0007
Further Details:      
 
Domain Number 3 Region: 288-350
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 2.21e-17
Family PHD domain 0.002
Further Details:      
 
Domain Number 4 Region: 1139-1222
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000288
Family PHD domain 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017918   Gene: ENSMPUG00000018029   Transcript: ENSMPUT00000018179
Sequence length 1662
Comment pep:novel scaffold:MusPutFur1.0:GL897084.1:255575:425030:-1 gene:ENSMPUG00000018029 transcript:ENSMPUT00000018179 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGVGPGGYAAEFVPPPECPVFEPSWEEFTDPLSFIGRIRPLAEKTGICKIRPPKDWQPP
FACEVKSFRFTPRVQRLNELEAMTRVRLDFLDQLAKFWELQGSTLKIPVVERKILDLYAL
SKIVASKGGFEMVTKEKKWSKVGSRLGYLPGKGTGSLLKSHYERILYPYELFQSGVSLMG
IQMPNLDLKEKVEPEVLGTDVQTSPEPGTRMNILPKRTRRVKSQSESGEVNRNTELKKLR
IFGAGPKVVGLAVGAKDKEDEVSRRRKVTNRSDAFNMQMRQRKGTLSVNFVDLYVCMFCG
RGNNEDKLLLCDGCDDSYHTFCLIPPLPDVPKGDWRCPKCVAEECNKPREAFGFEQAVRE
YTLQSFGEMADNFKSDYFNMPVHMVPTELVEKEFWRLVSSIEEDVIVEYGADISSKDFGS
GFPVKDGRRKMLPEEEEYALSGWNLNNMPVLEQSVLAHINVDISGMKVPWLYVGMCFSSF
CWHIEDHWSYSINYLHWGEPKTWYGVPSHAAEQLEEVMRELAPELFESQPDLLHQLVTIM
NPNVLMEHGVPVYRTNQCAGEFVVTFPRAYHSGFNQGYNFAEAVNFCTADWLPIGRQCVN
HYRRLRRHCVFSHEELIFKMAADPECLDVGLAAMVCKELTLMTEEETRLRESVVQMGVLM
SEEEVFELVPDDERQCSACRTTCFLSALTCSCNPERLVCLYHPTDLCPCPMQKKCLRYRY
PLEDLPSLLYGVKVRAQSYDTWVSRVTEALSANFNHKKDLIELRVMLEDAEDRKYPENDL
FRKLRDAVKEAETCASVAQLLLSKKQKHRQSPDSGRTRTKLTVEELKAFVQQLFSLPCVI
SQARQVKNLLDDVEEFHERAQEAMMDETPDSSKLQMLIDMGSSLYVELPELARLKQELQQ
ARWLDEVRLTLSDPQQVTLDVMKKLIDSGVGLAPHHAVEKAMAELQELLTVSERWEEKAK
VCLQARPRHSVASLESIVNEAKNIPAFLPNVLSLKEALQKAREWTAKVEAIQSGSNYAYL
EQLESLSAKGRPIPVRLDALPQVESQVAAARAWRERTGRTFLKKNSSHTLLQVLSPRTDI
GIYGSGKNRRKKVKELIEKEKEKDLDLEPLSDLEEGLEETRDTAMVVAVFKEREQKEIEA
MHSLRAANLAKMTMVDRIEEVKFCICRKTASGFMLQCELCKDWFHNSCVPLPKSGSQKKG
SSWQAKEVKFLCPLCMRSRRPRLETILSLLVSLQKLPVRLPEGEALQCLTERAMSWQDRA
RQALATDELSSALAKLSVLSQRMVEQAAREKTEKIISAELQKAAANPDLQGHLPSFQQSA
FNRVVSSVSSSPRQTMDYDDEETDSDEDIRETYGYDMKDTASVKSSSSLEPNLFCDEEIP
IKSEEVVTHMWTAPSFCAEHAYSSASKSCSQGSSTPRKQPRKSPLVPRSLEPPVLELSPG
AKAQLEELMMVGDLLEVSLDETQHIWRILQATHPPSEDRFLHIMEDDSMEEKPLKIKGKD
SSEKKRKRKLEKVEQLFGEGKQKSKELKKMDKPKKKKLKLSAEKSKELNKLAKKLAKEEE
RKKKKEKAAAAKVDLVKETTEKKREKKVLDIPSKYDWSGAEESDDENAVCAAQNCQRPCK
DKVDWVQCDGGWVWWEGASSIFLRVQLKVFRIFIELCNHHHN
Download sequence
Identical sequences M3Z2V6
ENSMPUP00000017918 ENSMPUP00000017918

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]