SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017946 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017946
Domain Number 1 Region: 31-99
Classification Level Classification E-value
Superfamily TRAF domain-like 0.0000000000235
Family SIAH, seven in absentia homolog 0.012
Further Details:      
 
Domain Number 2 Region: 610-656
Classification Level Classification E-value
Superfamily F-box domain 0.000000000157
Family F-box domain 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017946   Gene: ENSMPUG00000018057   Transcript: ENSMPUT00000018208
Sequence length 747
Comment pep:novel scaffold:MusPutFur1.0:GL896934.1:3916873:3962161:-1 gene:ENSMPUG00000018057 transcript:ENSMPUT00000018208 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEELQHSHCVNCVSRRCMIRPEPGISCDLIGCPLVCGAVFHSCKADEHRLLCPFERVPC
LNSDFGCPFTMARNKVAEHLEMCPASVVCCTMEWNRWPVSYADRKSYENLSRDVDEVAQL
DMALALQDQRMLLESLKVATMMSKATDKVSESREQISVKSSVPEIPHTNGLVSVDEESYG
ALYQATVETTRSLAAALDILNTATRDIGMLSTSLCASPNDMSEEQDPRGSLQNRHLKDQD
HFYEDEIGAVGGIDHNDTSLNVQSEQNGSSDLLCDSNNSSYATSALCNGFSLENICTQAI
DQNQKLHGDSKQSNLTNGECMASDGTSQPSSSLSVAAQLKEVIPSGALPNGTVQHILMPD
DEDEGALCWRKVDLGDLRNVDVLSFSHPPSFKFLSNSCWSKPKEDKAVDTSDLEVAEDPM
GLQGIDLITAALLFCLGDSPGGRGISDSRMVDVYHVDFGTQTFSLPSAILATNTMVGEIA
SASACDHANPQLSNPSPFQTLGLDLVLECVARYQPKQRSMFTFVCGQLFRRKEFSSHFKN
VHGDIHAGLNGWMEQRCPLAYYGCTYSQRRFCPSTQGAKIIHDRHLRSFGVQPCVSTVLV
EPARNCVLGLHSDHLSSLPFEVLQHIAGFLDGFSLCQLSCVSRLMRDVCGSLLQSRGMVI
LQWGKRKYPEGNSSWQIKEKVWRFSTAFCSVNEWKFADILSMADHLKKCSYNIVEKREEA
IPLPCMCVTRELTKEGRSLRSVLKPVL
Download sequence
Identical sequences M3Z2Y4
XP_004752822.1.14098 ENSMPUP00000017946 ENSMPUP00000017946

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]