SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017947 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017947
Domain Number 1 Region: 905-1004,1502-1676
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.17e-36
Family Tandem AAA-ATPase domain 0.0031
Further Details:      
 
Domain Number 2 Region: 715-778,805-887
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.22e-23
Family Tandem AAA-ATPase domain 0.0037
Further Details:      
 
Domain Number 3 Region: 440-514
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000000227
Family Linker histone H1/H5 0.0052
Further Details:      
 
Domain Number 4 Region: 653-717
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000421
Family PHD domain 0.0064
Further Details:      
 
Domain Number 5 Region: 260-322,367-397
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000797
Family Tandem AAA-ATPase domain 0.017
Further Details:      
 
Domain Number 6 Region: 1431-1484
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000447
Family RING finger domain, C3HC4 0.017
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000017947
Domain Number - Region: 1018-1075
Classification Level Classification E-value
Superfamily TPR-like 0.0493
Family Tetratricopeptide repeat (TPR) 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017947   Gene: ENSMPUG00000018058   Transcript: ENSMPUT00000018209
Sequence length 1683
Comment pep:known scaffold:MusPutFur1.0:GL896934.1:3981486:4070294:-1 gene:ENSMPUG00000018058 transcript:ENSMPUT00000018209 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSRRKRAPPVRVDEEKQQQLHWNMHEDRRNEPLTLTDDEHPSSGSDFSSAHCIILDDSL
KEEVAHQDKKRCSEAVSISKSKDKEETGGILSPLSAKLNIVISPYHFDNSWKAFLGELTL
QLLPEQSLIEHFSERSFTLMSSESSNHFLIYVNSECEDVEKQEKGLSEPISICDKGIRVE
SSFSGEMLEDLGWLQKKRRIKLYQKPEGNHMIKVGIYLLEGGLAKLDFLSDANSRMKKFN
QLMKRVMEKLHNFVIPDVLEEDEDDSESEPEGQDIDELYQFVKQIHQQEAQSIQVDVQHP
ALIPVLRPYQREAVNWMLRQERFRSPPTSENALHFLWREIVTSEGLKLYYNPYTGCIIRD
YPNAGPQLLGGILADEMGLGKTVEVLALILTHTRQDVKQDALTLPEGKVVNYFIPSHYSG
GKVKNTGSQNMEFEPKEKVQCPPTRVMILTAVKEMNGKKGVSILSIYKYVSSIYRYDVQR
NRSLLKRMLKCLIFEGLVKQIKGHGFSGTFTLGKNYKEEDICDKTKKQAVGSPRKIQKES
RKSGNKDTDSEYLPSNTSDDDDDPYYYYYKARKNRSKFRKKTVPSTKKGKGQPNISLSSQ
DQCPATSDSGITDVTTSKSTCIFEGKQEHAAGDQAESPADGDMPQSTVISPCNSSDYRFE
CICGELDQVDRKPRVQCLKCHLWQHAKCVNYEEKNLKIKPFYCPHCLVAMEPVSTRATLI
ISPSSICHQWVDEINRHVRSSSLRVLVYQGVKKDGFLQPHFLAEQDIVIITYDVLRSELN
YVDIPHSNSEDGRRLRNQKRYMAIPSPLVAVEWWRICLDEAQMVECPAVKAAEMAQRLSG
INRWCISGTPVQRGLEDLFGLVVFLGIEPYCVKHWWVRLLYRPYCKKNPQLLYSFIAEIL
WRSAKKDVIDQIQIPPQTEEIHWLHFSPVERHFYHRQHEVCCQDAVVKLRKISDWALKLS
SLDRRTVTSILYPLLRLRQACCHPQAVRGEFLPLQKSTMTMEELLTSLQKKCGTECEEAH
RQLVCALNGLAGIHIIKGEYALAAELYREVLRSSEEHKGKLKTDSLQRLHATHNLMELLV
AKHPGIPPTLRDGRLEEEAKQLREHYMSKCNTEVAEAQQALQPVQQTIRELQRKIYSNSP
WWLNVIHRAIEFAIDEELVQRVRNEITSNYKQQIDKLSMSEKFHDCRGLQFLLTTQMEEL
NKFQKLVREAVKNLEGPPSRNVIESATICHLRPTRLPLNCCVFCKADELFTEYESKLFSH
TVKGQTAIFEEMIEDEEGLVDDRIPTTSRGLWAVSETERSMKALLSFAKSHRFDVEFIDE
GSTSMDLFEAWKKEYKLLHEYWMALRNRVSAIDELAMATERLRVRHPKEPKPNPPVLHII
EPHEVEQNRIKLLNDKAVATSQLQKKLGQLLYLTNLEKSQDKTSGGINPEPCPICARQLG
KQWAVLTCGHCFCNECISIIIEQYSVGSHRSSIKCAICRQTTSHKEISYVFTSEKANQEE
DIPVKGSHSTKVEAVVRTLMRIQLRDPGAKALVFSTWQDVLDIISKALTDNNMEFAQISR
VKTFQENLSAFKHDPQINILLLPLHTGSNGLTIIEATHVLLVEPILNPAHELQAIGRVHR
IGQTKPTIVHRFLIKATIEERMQAMLKTAEKSHTNSSVKHPEASVLTLADLADLFTKETE
ELE
Download sequence
Identical sequences M3Z2Y5
ENSMPUP00000017947 XP_004752823.1.14098 XP_004752824.1.14098 ENSMPUP00000017947

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]