SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000017996 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000017996
Domain Number 1 Region: 9-186
Classification Level Classification E-value
Superfamily Cyclophilin-like 3.51e-74
Family Cyclophilin (peptidylprolyl isomerase) 0.0000000126
Further Details:      
 
Domain Number 2 Region: 223-368
Classification Level Classification E-value
Superfamily TPR-like 8.3e-29
Family Tetratricopeptide repeat (TPR) 0.000000334
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000017996   Gene: ENSMPUG00000018108   Transcript: ENSMPUT00000018259
Sequence length 370
Comment pep:known scaffold:MusPutFur1.0:GL897140.1:1127613:1139516:-1 gene:ENSMPUG00000018108 transcript:ENSMPUT00000018259 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSHPSPKTKPSNPCNPRVFFDVDIGGERVGRIVLELFADIVPKTAENFRALCTGEKGIGP
TTGKPLHFKGCPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFYYKHDQEGLLSM
ANAGCNTNGSQFFITTVPTPHLDGKHVVFGQVIKGMGVARILENVEVKGEKPAKLCVIAE
CGELKEGDDWGIYPKDGSGDSHPDFPEDADIDLKDVNKILLIAEDVKNIGNTFFKSQNWE
MAIKKYTKVLRYVEGSKAVIEQADRSKLQPIALSCVLNIGACKLKMSNWQGAIDSCLEAL
ELDPSNTKALYRRAQGWQGLKEYDQALADLKKAQEIAPEDKAIQAELLKVKQKIKAQKDK
EKAAYAKMFA
Download sequence
Identical sequences M3Z334
XP_004777378.1.14098 ENSMPUP00000017996 ENSMPUP00000017996

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]