SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000018078 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000018078
Domain Number 1 Region: 15-159
Classification Level Classification E-value
Superfamily Cyclophilin-like 4.82e-71
Family Cyclophilin (peptidylprolyl isomerase) 0.0000000903
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000018078   Gene: ENSMPUG00000018190   Transcript: ENSMPUT00000018342
Sequence length 159
Comment pep:novel scaffold:MusPutFur1.0:GL896901.1:13601777:13603401:-1 gene:ENSMPUG00000018190 transcript:ENSMPUT00000018342 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GCRAADARGRLPRSFLLQLFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGG
DFTRHNGTGGKSIYGEKFDDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGK
HVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIADCGQI
Download sequence
Identical sequences M3Z3B6
ENSMPUP00000018078 ENSMPUP00000018078

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]