SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMPUP00000018123 from Mustela putorius furo 69_1.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMPUP00000018123
Domain Number 1 Region: 438-766
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 5.23e-51
Family Patatin 0.0033
Further Details:      
 
Weak hits

Sequence:  ENSMPUP00000018123
Domain Number - Region: 348-434
Classification Level Classification E-value
Superfamily ARM repeat 0.0158
Family Clathrin heavy-chain linker domain 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMPUP00000018123   Gene: ENSMPUG00000018237   Transcript: ENSMPUT00000018389
Sequence length 781
Comment pep:known scaffold:MusPutFur1.0:GL896901.1:16212134:16243641:1 gene:ENSMPUG00000018237 transcript:ENSMPUT00000018389 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSINLTIDIYYIYLLSNARSLCGKQRSKQLHFLYSPKHYWRISHASLQRGFHTSKIRCKL
TKSDAHSWRKHCYSPNHHGLHIGILKLSTSTPKGLTKVSIRMSRIKSTLNSVSKAVFGTQ
NEMISRLAQFKPSSRILRKVSDSGWLKQTGIKQAIKSLKKYSDKSVEKSSFSESHSVGKD
EDIGKQSLFRYTSSLTTRFGESFYFLSNHINSYFKREERMSQKKEKKHFQDKLEDKKVEE
EKSSSPDPGILTDKRDSESSLYSVDKSASASGTPEALPVSTKQSIANFLSRPTEGVQALV
GGYIGGLVPKLKYDSKSQPEEQEEAVKAEQPVSKDKNGEEKKRLSLQREKIIARVSIDNR
TRALVQALRRTTDPKLCINRVEELTFHLLEFPEGKGVAVKEKIIPYLLRLRQIKDETLQA
AVREILALIGYVDPVKGRGIRILTIDGGGTSRGVVALQTLRKLVELTQKPVHQLFDYICG
VSTGAILAFMLGLFHMPLDECEELYRKLGSDVFSQNVIVGTVKMSWSHAFYDSQTWENIL
KDRMGSSLMIETARNPTCPKVAAVSTIVNRGITPKAFVFRNYGHFPGINSHYLGGCQYKM
WQAIRASSAAPGYFAEYALGNDLHQDGGLLLNNPSALAMHECKCLWPDVPLECIVSLGTG
RYESDVRNSVTYTSLKTKLSNVINSATDTEEVHVMLDGLLPPDTYFRFNPVMCENIPLDE
SRNEKLNQLQLEGLKYIERNEEKMKKLAKILTQEKTTLQKINDWIKLKTDMYEGLPFFSK
L
Download sequence
Identical sequences M3Z3G1
ENSMPUP00000018123 ENSMPUP00000018123

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]